RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G351990
Reference: TK1151 Chr: Chr04 Coordinates: 88798526-88802173 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2430 bp · TkA04G351990|TK1151|cDNA

ATCAAACTTCACAACAGGTAGGGCAAGAAAGTGTGAATTTTGTGGGGTTTTTTAACAAGTACGGATAAACAGTAAGGGGGTGTAGGTGTCATAACCCAATTCTTCGTCATAATTGGTTATCTTGCCATCATATTCTTTACCTTCGCTGGATTATATATGTACACACGCTAATCCTCACACAATCTTCCTGTAGTCTGTGTATATATAGTAACAGGCATCGGTTTCCACTCGGTGAAATTGCCCGCGGTTTCTTTCTTCTT...

CDS

Download CDS FASTA

2004 bp · TkA04G351990|TK1151|CDS

ATGACCAGCTATACACCAAAAAACATCCTCATCACCGGAGCTGCCGGCTTCATCGCCTCTCATGTCGCCAACCGCCTTATCAGAAGCTACCCAGACTACAAGATCGTCGTTCTCGACAAACTCGATTACTGCTCAAATCTCAAAAACCTCAATCCCTCAAAATCATCCCCCAACTTCAAATTCGTCAAAGGCGACATCGGTAGTGCAGATCTAGTCAACTACCTTCTCATCACCGAAAACATCGACACCATAATGCACTT...

Protein

Download Protein FASTA

667 aa · TkA04G351990|TK1151|PROTEIN

MTSYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTRQIRRFIHVSTDEVYGETEEDAIVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLPVITTRGNNVYGPNQFPEKLIPKFILLAMRGKPLPIHGDGSNVRSYLYCEDVAEAFEVILHKGEVGHVYNIGTKKERRVID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G351990
TK1151 IDTkA04G351990
OH-1004 IDLXL04_039840
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 83.899
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G351990
LocationChr04:88798526-88802173 (-)
DescriptionSimilar to RHM1: Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g78570 Trifunctional enzyme involved in UDP-beta-L-rhamnose biosynthesis, a precursor of the primary cell wall components rhamnogalacturonan I (RG-I) and rhamnogalacturonan II (RG-II).
Functional analysis of Arabidopsis thaliana RHM2/MUM4, a multidomain protein involved in UDP-D-glucose to UDP-L-rhamnose conversion.2007 · DOI: 10.1074/jbc.m610196200
Comprehensive flavonol profiling and transcriptome coexpression analysis leading to decoding gene-metabolite correlations in Arabidopsis.2008 · DOI: 10.1105/tpc.108.058040
Overexpression of a cytosol-localized rhamnose biosynthesis protein encoded by Arabidopsis RHM1 gene increases rhamnose content in cell wall.2009 · DOI: 10.1016/j.plaphy.2008.10.011
At3g14790 Trifunctional enzyme involved in UDP-beta-L-rhamnose biosynthesis, a precursor of the primary cell wall components rhamnogalacturonan I (RG-I) and rhamnogalacturonan II (RG-II).
Functional analysis of Arabidopsis thaliana RHM2/MUM4, a multidomain protein involved in UDP-D-glucose to UDP-L-rhamnose conversion.2007 · DOI: 10.1074/jbc.m610196200
At1g53500 Trifunctional enzyme involved in UDP-beta-L-rhamnose biosynthesis, a precursor of the primary cell wall components rhamnogalacturonan I (RG-I) and rhamnogalacturonan II (RG-II).
RHM2 is involved in mucilage pectin synthesis and is required for the development of the seed coat in Arabidopsis.2004 · DOI: 10.1104/pp.103.034314
Functional analysis of Arabidopsis thaliana RHM2/MUM4, a multidomain protein involved in UDP-D-glucose to UDP-L-rhamnose conversion.2007 · DOI: 10.1074/jbc.m610196200
At1g63000 Bifunctional enzyme involved in dTDP-beta-L-rhamnose biosynthesis. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_039840 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009225 nucleotide-sugar metabolic process Biological Process
GO:0010192 mucilage biosynthetic process Biological Process
GO:0010214 seed coat development Biological Process
GO:0010253 UDP-rhamnose biosynthetic process Biological Process
GO:0010315 auxin export across the plasma membrane Biological Process
GO:0019300 rhamnose biosynthetic process Biological Process
GO:0019305 dTDP-rhamnose biosynthetic process Biological Process
GO:0030154 cell differentiation Biological Process
GO:0042127 regulation of cell population proliferation Biological Process
GO:0051555 flavonol biosynthetic process Biological Process
GO:0071555 cell wall organization Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT1G53500
ath:AT1G63000
ath:AT1G78570
ath:AT3G14790
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.638
Rank 1 · TkA04G351990 · TK1151
Nucleus0.249
Rank 2 · TkA04G351990 · TK1151
Mitochondrion0.135
Rank 3 · TkA04G351990 · TK1151
Peroxisome0.129
Rank 4 · TkA04G351990 · TK1151
Cell membrane0.050
Rank 5 · TkA04G351990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short7-72 aa
PF04321RmlD_sub_bind8-318 aa
PF01370Epimerase9-251 aa
PF02719Polysacc_synt_29-283 aa
PF16363GDP_Man_Dehyd10-315 aa
PF010733Beta_HSD10-235 aa
PF07993NAD_binding_411-191 aa
PF13460NAD_binding_1013-170 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G351990PF00106adh_short7720.004717.1
TkA04G351990PF04321RmlD_sub_bind83184e-30105.6
TkA04G351990PF01370Epimerase92511.4e-71241.4
TkA04G351990PF02719Polysacc_synt_292831.7e-28100.4
TkA04G351990PF16363GDP_Man_Dehyd103151.3e-74252.4
TkA04G351990PF010733Beta_HSD102357.7e-2898.0
TkA04G351990PF07993NAD_binding_4111911.4e-2487.4
TkA04G351990PF13460NAD_binding_10131700.02115.4
TkA04G351990PF00106adh_short1571770.004717.1
TkA04G351990PF04321RmlD_sub_bind3845564e-30105.6
TkA04G351990PF01370Epimerase3875381.4e-71241.4
TkA04G351990PF16363GDP_Man_Dehyd4085521.3e-74252.4
TkA04G351990PF02719Polysacc_synt_24154761.7e-28100.4
TkA04G351990PF00106adh_short4344700.004717.1
TkA04G351990PF07993NAD_binding_44465361.4e-2487.4
TkA04G351990PF010733Beta_HSD4515277.7e-2898.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SYM5Arabidopsis thalianasp|Q9SYM5|RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM187.200%Swiss-ProtHigh
Q9LH76Arabidopsis thalianasp|Q9LH76|RHM3_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM383.600%Swiss-ProtHigh
Q9LPG6Arabidopsis thalianasp|Q9LPG6|RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM283.300%Swiss-ProtHigh
Q9LQ04Arabidopsis thalianasp|Q9LQ04|RMLCD_ARATH Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase82.500%Swiss-ProtLow

JBrowse

View in Genome Browser