Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1198 bp · TkA04G349230|TK1151|cDNA
GGGCGTCGATTTCCGCTTCTTCCTTGTTCGGTTGTTCACTCTTTAAGATTCAACACCACACATGATTCACGAACGAAACCTCAAGTCGCACCCACTCGGACGCCATCGACCAACTTTCTCCGGCCACAAAACATCCAGCGTCGTCGCCTCAAGCGCACGCACAGAAGCAAGCACAGACGCACGCATAGACGCATGCTATTGGCCATTTCTGTGACTGTGAGGATTGAGCGACTTATCCCGATTGGAACTTCTGAAGAACA...
909 bp · TkA04G349230|TK1151|CDS
GGGCGTCGATTTCCGCTTCTTCCTTGTTCGGTTGTTCACTCTTTAAGATTCAACACCACACATGATTCACGAACGAAACCTCAAGTCGCACCCACTCGGACGCCATCGACCAACTTTCTCCGGCCACAAAACATCCAGCGTCGTCGCCTCAAGCGCACGCACAGAAGCAAGCACAGACGCACGCATAGACGCATGCTATTGGCCATTTCTGTGACTGTGAGGATTGAGCGACTTATCCCGATTGGAACTTCTGAAGAACA...
Protein
Download Protein FASTA302 aa · TkA04G349230|TK1151|PROTEIN
GRRFPLLPCSVVHSLRFNTTHDSRTKPQVAPTRTPSTNFLRPQNIQRRRLKRTHRSKHRRTHRRMLLAISVTVRIERLIPIGTSEEQRHSGHYRLQIGFDFAKIFWFDSSKLLQSTFNHSDNQTTSSGLRGCWFGIANMILVKRMRETLYYVLIIKCIKIWVLTVNATMDAADLVAKLRAYHHIEQKKADKKHLSSAIIGDNFIAENVTFENDAHEGSHQAVAVRISAKCCAFYNCRLLGFQEQMKNYKHLDDESDAVDP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G349230 |
|---|---|
| TK1151 ID | TkA04G349230 |
| OH-1004 ID | LXL04_023545 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 69.500 |
| Protein coverage (%) | TK1151 42.384 / OH-1004 67.544Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G349230 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:88181334-88184190 (+) | |||||||||
| Description | Similar to PME31: Pectinesterase 31 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006629 lipid metabolic process Biological Process GO:0042545 cell wall modification Biological Process GO:0045488 pectin metabolic process Biological Process GO:0045490 pectin catabolic process Biological Process GO:0048358 mucilage pectin biosynthetic process Biological Process GO:0050829 defense response to Gram-negative bacterium Biological Process GO:0005634 nucleus Cellular Component GO:0005777 peroxisome Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0004857 enzyme inhibitor activity Molecular Function GO:0030599 pectinesterase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G05610 ath:AT3G29090 ath:AT5G27870 ath:AT5G49180 cit:102578056 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF28565RNF216P152-70 aaPF07687M20_dimer165-244 aaPF01095Pectinesterase195-248 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G349230 | PF28565 | RNF216P1 | 52 | 70 | 0.35 | 11.4 |
| TkA04G349230 | PF07687 | M20_dimer | 165 | 244 | 0.17 | 12.6 |
| TkA04G349230 | PF01095 | Pectinesterase | 195 | 248 | 7.2e-11 | 42.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.