TkA04G348680 | RubberDandelionOmics

Gene overview

TkA04G348680

Reference: TK1151 Chr: Chr04 Coordinates: 88087111-88087484 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

303 bp · TkA04G348680|TK1151|cDNA

GGGTCAATATCAGCAAGCACGTGCATATATGAAACAAATTACTGTTTCATTTGCACTCACTTAACATCTGCTAAGAGGGAAGTTGATCTAATTAAAAGAAATGCTAACGTGGGTGAAATACATAAAATAACAAGTTTTAATTCCATGTCAAAAGTCTCACTTCCAAGGACCATGAGTAAGTATACGAGAATAATTTGGTTAGGTGATCTTAATTACCGTATCAATCTACCATATGAGGAAACACGTGACCTAATTTCCAA...

CDS

Download CDS FASTA

303 bp · TkA04G348680|TK1151|CDS

GGGTCAATATCAGCAAGCACGTGCATATATGAAACAAATTACTGTTTCATTTGCACTCACTTAACATCTGCTAAGAGGGAAGTTGATCTAATTAAAAGAAATGCTAACGTGGGTGAAATACATAAAATAACAAGTTTTAATTCCATGTCAAAAGTCTCACTTCCAAGGACCATGAGTAAGTATACGAGAATAATTTGGTTAGGTGATCTTAATTACCGTATCAATCTACCATATGAGGAAACACGTGACCTAATTTCCAA...

Protein

Download Protein FASTA

100 aa · TkA04G348680|TK1151|PROTEIN

GSISASTCIYETNYCFICTHLTSAKREVDLIKRNANVGEIHKITSFNSMSKVSLPRTMSKYTRIIWLGDLNYRINLPYEETRDLISKSDWPKLLESDQVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G348680`
TK1151 ID	TkA04G348680
OH-1004 ID	LXL04_003450
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.700
Protein coverage (%)	TK1151 97.000 / OH-1004 28.280 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G348680

Location Chr04:88087111-88087484 (-)

Description Similar to IP5P3: Type IV inositol polyphosphate 5-phosphatase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71710`	Has phosphatase activity toward PtdIns(4,5)P2 and PtdIns(3,4,5)P3.	No verified direct reference in this release
`At1g34120`	Has phosphatase activity toward Ins(1,4,5)P3 and Ins(1,3,4,5)P4, but not toward Ins(1,4)P2, Ins(1)P.	No verified direct reference in this release
`At5g65090`	May be involved in the regulation of root hairs development.	Genetic interactions during root hair morphogenesis in Arabidopsis.2000 · DOI: 10.1105/tpc.12.10.1961 Analysis of the root-hair morphogenesis transcriptome reveals the molecular identity of six genes with roles in root-hair development in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02609.x
`At5g04980`	Type I inositol polyphosphate 5-phosphatase 10.	No verified direct reference in this release
`At1g05470`	May have phosphatase activity toward PtdIns(4,5)P₂ and PtdIns(3,4,5)P₃.	Genetic regulation of vascular tissue patterning in Arabidopsis.1999 · DOI: 10.1105/tpc.11.11.2123 Cotyledon vascular pattern2-mediated inositol (1,4,5) triphosphate signal transduction is essential for closed venation patterns of Arabidopsis foliar organs.2004 · DOI: 10.1105/tpc.021030 CVP2- and CVL1-mediated phosphoinositide signaling as a regulator of the ARF GAP SFC/VAN3 in establishment of foliar vein patterns.2009 · DOI: 10.1111/j.1365-313x.2009.03920.x Primary root protophloem differentiation requires balanced phosphatidylinositol-4,5-biphosphate levels and systemically affects root branching.2015 · DOI: 10.1242/dev.118364

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003450 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0032957 inositol trisphosphate metabolic process Biological Process

GO:0043647 inositol phosphate metabolic process Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

GO:0090351 seedling development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0004439 phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity Molecular Function

GO:0004445 inositol-polyphosphate 5-phosphatase activity Molecular Function

GO:0034485 phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity Molecular Function

GO:0046030 inositol trisphosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G34120

ath:AT1G71710

ath:AT2G37440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.475

Rank 1 · TkA04G348680 · TK1151

Nucleus0.165

Rank 2 · TkA04G348680 · TK1151

Peroxisome0.144

Rank 3 · TkA04G348680 · TK1151

Mitochondrion0.141

Rank 4 · TkA04G348680 · TK1151

Cell membrane0.078

Rank 5 · TkA04G348680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22669Exo_endo_phos21-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G348680	`PF22669`	Exo_endo_phos2	1	99	3.8e-17	63.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0Z6`	Arabidopsis thaliana	sp\|Q8H0Z6\|IP5P3_ARATH Type IV inositol polyphosphate 5-phosphatase 3	59.000%	Swiss-Prot	High
`Q84MA2`	Arabidopsis thaliana	sp\|Q84MA2\|IP5P1_ARATH Type I inositol polyphosphate 5-phosphatase 1	51.500%	Swiss-Prot	High
`Q66GQ6`	Arabidopsis thaliana	sp\|Q66GQ6\|IP5P5_ARATH Type I inositol polyphosphate 5-phosphatase 5	45.100%	Swiss-Prot	Medium
`A8MR21`	Arabidopsis thaliana	sp\|A8MR21\|IP5PA_ARATH Type I inositol polyphosphate 5-phosphatase 10	48.000%	Swiss-Prot	Medium
`Q9LR47`	Arabidopsis thaliana	sp\|Q9LR47\|IP5P6_ARATH Type IV inositol polyphosphate 5-phosphatase 6	46.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card