TkA04G348220 | RubberDandelionOmics

Gene overview

TkA04G348220

Reference: TK1151 Chr: Chr04 Coordinates: 87974918-87978190 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1485 bp · TkA04G348220|TK1151|cDNA

TTCAGAGTTTTCATCTAACAGAGCAAAAGGTAGAGGCCATGGAGAACAAAAAAGGCTCCAAGATGAACATCGCAATCATTCATCCTGATCTCGGAATCGGAGGAGCGGAAAGGTTAATAGTTGATGCAGCAGTTGAACTTGCATCTCAAGGACATAATGTCCACATTTTCACATCACACCATGATAGAAACCGCTGTTTTGAGGAGACCCTTGCAGGTACATTTGCAGTTACAGTTTATGGATCATTTCTTCCTAGACAC...

CDS

Download CDS FASTA

1203 bp · TkA04G348220|TK1151|CDS

ATGGAGAACAAAAAAGGCTCCAAGATGAACATCGCAATCATTCATCCTGATCTCGGAATCGGAGGAGCGGAAAGGTTAATAGTTGATGCAGCAGTTGAACTTGCATCTCAAGGACATAATGTCCACATTTTCACATCACACCATGATAGAAACCGCTGTTTTGAGGAGACCCTTGCAGGTACATTTGCAGTTACAGTTTATGGATCATTTCTTCCTAGACACATCTTCTATCGCCTTCATGCAGTATGCGCGTATATTCG...

Protein

Download Protein FASTA

400 aa · TkA04G348220|TK1151|PROTEIN

MENKKGSKMNIAIIHPDLGIGGAERLIVDAAVELASQGHNVHIFTSHHDRNRCFEETLAGTFAVTVYGSFLPRHIFYRLHAVCAYIRCIFVALCVLFKFPSFDVVLADQVSVVIPILKLRKSTKVVFYCHFPDMLLAKYTTLLRRIYRKPINFLEELTTGMADLILVNSNFTKSTFAATFKRLDAQGIKPAVLYPAVNVDQFTEPNAYKLNFLSINRFEKKKNIDLAISAFAMLKSPDVTLTIAGGFDERLRENVDYLEQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G348220`
TK1151 ID	TkA04G348220
OH-1004 ID	LXL04_013950
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	25.900
Protein coverage (%)	TK1151 32.000 / OH-1004 16.528 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G348220`
Location	Chr04:87974918-87978190 (+)
Description	Similar to SUS6: Sucrose synthase 6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013950` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005985 sucrose metabolic process Biological Process GO:0080165 callose deposition in phloem sieve plate Biological Process GO:0005737 cytoplasm Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0016157 sucrose synthase activity Molecular Function
KEGG gene cross-reference	ath:AT1G73370 dosa:Os02g0831500 dosa:Os04g0249500 dosa:Os04g0309600 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.365

Rank 1 · TkA04G348220 · TK1151

Cytoplasm0.265

Rank 2 · TkA04G348220 · TK1151

Mitochondrion0.159

Rank 3 · TkA04G348220 · TK1151

Golgi apparatus0.124

Rank 4 · TkA04G348220 · TK1151

Nucleus0.124

Rank 5 · TkA04G348220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02350Epimerase_25-51 aa

PF13439Glyco_transf_420-200 aa

PF13579Glyco_trans_4_421-178 aa

PF13524Glyco_trans_1_250-66 aa

PF20706GT4-conflict187-326 aa

PF00534Glycos_transf_1210-369 aa

PF13692Glyco_trans_1_4212-356 aa

PF02350Epimerase_2263-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G348220	`PF02350`	Epimerase_2	5	51	0.1	12.2
TkA04G348220	`PF13439`	Glyco_transf_4	20	200	1.9e-16	61.3
TkA04G348220	`PF13579`	Glyco_trans_4_4	21	178	8.4e-07	30.2
TkA04G348220	`PF13524`	Glyco_trans_1_2	50	66	0.019	15.6
TkA04G348220	`PF20706`	GT4-conflict	187	326	1.6e-06	28.1
TkA04G348220	`PF00534`	Glycos_transf_1	210	369	8.4e-39	133.6
TkA04G348220	`PF13692`	Glyco_trans_1_4	212	356	2.6e-21	77.1
TkA04G348220	`PF02350`	Epimerase_2	263	362	0.1	12.2
TkA04G348220	`PF13524`	Glyco_trans_1_2	273	377	0.019	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card