TkA04G344950 | RubberDandelionOmics

Gene overview

TkA04G344950

Reference: TK1151 Chr: Chr04 Coordinates: 87213275-87214357 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · TkA04G344950|TK1151|cDNA

ATGGGTACAGTCAGATCCGAGGCGCTAATGCGATGGGTTTGGGAAGCTAACCGGGGCAACCCGGTCCGTGAAAACGCTACTCTCACCTTCGGTACAGACGGAAACCTTATCCTGGCGGATTCTGATGGCCGGATTGCTTGGCAAACTAACACTGCCAACAAAGGTGTCGTCGGATTTCAAGTCCTTCCTACCGGAAACATGGTTCTTCATGATGGAAAAGGTAACTTCATATGGCAAAGCTTCGATTCACCTACTGACAC...

CDS

Download CDS FASTA

1083 bp · TkA04G344950|TK1151|CDS

ATGGGTACAGTCAGATCCGAGGCGCTAATGCGATGGGTTTGGGAAGCTAACCGGGGCAACCCGGTCCGTGAAAACGCTACTCTCACCTTCGGTACAGACGGAAACCTTATCCTGGCGGATTCTGATGGCCGGATTGCTTGGCAAACTAACACTGCCAACAAAGGTGTCGTCGGATTTCAAGTCCTTCCTACCGGAAACATGGTTCTTCATGATGGAAAAGGTAACTTCATATGGCAAAGCTTCGATTCACCTACTGACAC...

Protein

Download Protein FASTA

360 aa · TkA04G344950|TK1151|PROTEIN

MGTVRSEALMRWVWEANRGNPVRENATLTFGTDGNLILADSDGRIAWQTNTANKGVVGFQVLPTGNMVLHDGKGNFIWQSFDSPTDTLLVGQSLKSGGASKLVSRASAMNNVNGAYSLVMEPKQLAMYYKSPNSPRPMLYWSSAEWFTIDKGSLANLTLTSVPDTDEGFLYYLVFDYFTKNPSSNQNRYMAYSRYNNTLSYLRLGIDGNLRFYTYNPNVQGVAWELVYTFLDRDSMEGECQLPERCGKFGLCENNQCVAC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G344950`
TK1151 ID	TkA04G344950
OH-1004 ID	LXL04_037750
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 81.633 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G344950

Location Chr04:87213275-87214357 (-)

Description Similar to At1g78850: EP1-like glycoprotein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78860`	EP1-like glycoprotein 4.	No verified direct reference in this release
`At1g78850`	May be involved in a cell-to cell programmed cell death (PCD) signaling mechanism.	No verified direct reference in this release
`At1g78830`	EP1-like glycoprotein 2.	No verified direct reference in this release
`At1g78820`	EP1-like glycoprotein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037750 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1904383 response to sodium phosphate Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT1G78820

ath:AT1G78830

ath:AT1G78850

ath:AT1G78860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.722

Rank 1 · TkA04G344950 · TK1151

Cell membrane0.157

Rank 2 · TkA04G344950 · TK1151

Endoplasmic reticulum0.064

Rank 3 · TkA04G344950 · TK1151

Cytoplasm0.043

Rank 4 · TkA04G344950 · TK1151

Plastid0.037

Rank 5 · TkA04G344950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin13-96 aa

PF00954S_locus_glycop152-265 aa

PF01453B_lectin199-213 aa

PF00024PAN_1212-241 aa

PF14295PAN_4240-253 aa

PF00024PAN_1272-285 aa

PF08276PAN_2306-336 aa

PF00024PAN_1309-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G344950	`PF01453`	B_lectin	13	96	6.7e-19	69.0
TkA04G344950	`PF00954`	S_locus_glycop	152	265	5.6e-08	34.0
TkA04G344950	`PF01453`	B_lectin	199	213	6.7e-19	69.0
TkA04G344950	`PF00024`	PAN_1	212	241	2.2	8.9
TkA04G344950	`PF14295`	PAN_4	240	253	6.2	7.7
TkA04G344950	`PF00024`	PAN_1	272	285	2.2	8.9
TkA04G344950	`PF08276`	PAN_2	306	336	0.0031	18.3
TkA04G344950	`PF00024`	PAN_1	309	336	2.2	8.9
TkA04G344950	`PF14295`	PAN_4	309	335	6.2	7.7
TkA04G344950	`PF00954`	S_locus_glycop	311	326	5.6e-08	34.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVA5`	Arabidopsis thaliana	sp\|Q9ZVA5\|EP1L4_ARATH EP1-like glycoprotein 4	51.200%	Swiss-Prot	High
`Q9ZVA4`	Arabidopsis thaliana	sp\|Q9ZVA4\|EP1L3_ARATH EP1-like glycoprotein 3	50.400%	Swiss-Prot	High
`Q9ZVA2`	Arabidopsis thaliana	sp\|Q9ZVA2\|EP1L2_ARATH EP1-like glycoprotein 2	44.600%	Swiss-Prot	Medium
`Q9ZVA1`	Arabidopsis thaliana	sp\|Q9ZVA1\|EP1L1_ARATH EP1-like glycoprotein 1	44.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card