TkA04G343150 | RubberDandelionOmics

Gene overview

TkA04G343150

Reference: TK1151 Chr: Chr04 Coordinates: 86682019-86701763 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2237 bp · TkA04G343150|TK1151|cDNA

TACAAATTTATGAAAAAGCTCTTAAATAAAAGCCAAAAAACTTTGCTTTTTAATGTGAAAAGTTTTATAAAAAACTGCCAACGAAGACTAAATCATGATCCAAGCATTATTGGGCGTGAGCTAGTCGGCTACCGTCTGGCTGACGTGATGGTACCGTGGGACCTTGTTCTTCAATGCACACTTCCGCTCACCAAGCTACAAGTCAAAGGAAGCTTTTCTGTTCAAAGTCTCCCATCATTCTTATATCTCCTTTGTTGACA...

CDS

Download CDS FASTA

1197 bp · TkA04G343150|TK1151|CDS

ATGGCTAAATTCAGTTGCTGTTTTGGGGGCGTAGTTTCCTCACGTGGTGGTGGTGTTCATAGAGTAAACAATAGGGGAAGCAACACTGATATTAGTGTAGAACTTTTGGATATTAACAATATGCGATTGTACACATACAAAGATTTGCAAACTGCTACACAAGATTTTAATCCCGATACTAAGATAGGACAGGGAGGTTTCGGTTCCGTTTATAAGGGACAACTAAAAGATGGCAAATTAGTTGCTATAAAAGTGCTCTC...

Protein

Download Protein FASTA

398 aa · TkA04G343150|TK1151|PROTEIN

MAKFSCCFGGVVSSRGGGVHRVNNRGSNTDISVELLDINNMRLYTYKDLQTATQDFNPDTKIGQGGFGSVYKGQLKDGKLVAIKVLSTESRQGLREFLTEITIISDIQHENLVKLHGYCVEKDHRILVYGYLKNGSLDRTLLDGEDCSIKFTWEIRRKICIGVAKGLAYLHEEVQPHVIHRDIKASNILLDEDFTPKISDFGLAKLFPSHLTHVSTRIAGTQGYLAPEYAIRGQLTRKADIYSFGVLLLEIVSGRPNQSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G343150`
TK1151 ID	TkA04G343150
OH-1004 ID	LXL04_037719
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.800
Protein coverage (%)	TK1151 89.447 / OH-1004 66.855 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G343150

Location Chr04:86682019-86701763 (-)

Description Similar to CRPK1: Cold-responsive protein kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16670`	Negative regulator of freezing tolerance that phosphorylates 14-3-3 proteins (e.g. GRF6) thus triggering their translocation from the cytosol to the nucleus in response to cold stress.	No verified direct reference in this release
`At1g56130`	Probable LRR receptor-like serine/threonine-protein kinase At1g56130.	No verified direct reference in this release
`At1g56140`	Probable LRR receptor-like serine/threonine-protein kinase At1g56140.	No verified direct reference in this release
`At3g14840`	Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840.	No verified direct reference in this release
`At1g53430`	Probable LRR receptor-like serine/threonine-protein kinase At1g53430.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037719 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0009409 response to cold Biological Process

GO:0009625 response to insect Biological Process

GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050826 response to freezing Biological Process

GO:0052542 defense response by callose deposition Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G16670

ath:AT1G53430

ath:AT1G56130

ath:AT1G56140

ath:AT3G14840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.716

Rank 1 · TkA04G343150 · TK1151

Cytoplasm0.229

Rank 2 · TkA04G343150 · TK1151

Nucleus0.169

Rank 3 · TkA04G343150 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA04G343150 · TK1151

Golgi apparatus0.032

Rank 5 · TkA04G343150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase58-259 aa

PF07714PK_Tyr_Ser-Thr59-324 aa

PF03109ABC160-96 aa

PF24476DUF7580144-264 aa

PF03109ABC1168-206 aa

PF01636APH168-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G343150	`PF00069`	Pkinase	58	259	1.2e-47	163.2
TkA04G343150	`PF07714`	PK_Tyr_Ser-Thr	59	324	3.8e-46	158.2
TkA04G343150	`PF03109`	ABC1	60	96	6.5e-06	26.2
TkA04G343150	`PF24476`	DUF7580	144	264	0.25	11.7
TkA04G343150	`PF03109`	ABC1	168	206	6.5e-06	26.2
TkA04G343150	`PF01636`	APH	168	203	0.4	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YN1`	Arabidopsis thaliana	sp\|Q93YN1\|CRPK1_ARATH Cold-responsive protein kinase 1	65.800%	Swiss-Prot	High
`C0LGH2`	Arabidopsis thaliana	sp\|C0LGH2\|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130	51.800%	Swiss-Prot	High
`C0LGH3`	Arabidopsis thaliana	sp\|C0LGH3\|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140	52.900%	Swiss-Prot	High
`C0LGN2`	Arabidopsis thaliana	sp\|C0LGN2\|Y3148_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840	50.000%	Swiss-Prot	High
`C0LGG8`	Arabidopsis thaliana	sp\|C0LGG8\|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430	54.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card