TkA04G337570 | RubberDandelionOmics

Gene overview

TkA04G337570

Reference: TK1151 Chr: Chr04 Coordinates: 85300741-85307332 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2158 bp · TkA04G337570|TK1151|cDNA

AAATATTTGAAGATTAATATTTTCCTAAAAAGAGAAGTTGAAACTTGAATTTCTAATATTTTTTTAATAGAAGTTGAAAAAAAAAAAAAATCTTTCTGACCCTCTTTCGACGGTTATTAGATCCCATCACCAGTGATCGAACCAGATCGTCGCCGGCCACATGGCGAGCAATTCGCTTCTCTTACTCACACTCTCAACTCTCCTCATCTTCACCGTCTCCGGCCGTGTAATCACCACCACGACGACGACTTCAACATCAG...

CDS

Download CDS FASTA

1737 bp · TkA04G337570|TK1151|CDS

ATGGCGAGCAATTCGCTTCTCTTACTCACACTCTCAACTCTCCTCATCTTCACCGTCTCCGGCCGTGTAATCACCACCACGACGACGACTTCAACATCAGATCTCGTCTCTGACGGCGTTCACGATGGCCAAGGCGGCATACTTCGTCTTAACCCCTTCGTATCAGCTGAGGAACCAGAAGCTTGCGAGCAGTCGTACGGATTCTTACCTTGCACCAACACAGCGCTTGGCAACGTCTTCCTCATTTTGGTCTATGGGTA...

Protein

Download Protein FASTA

578 aa · TkA04G337570|TK1151|PROTEIN

MASNSLLLLTLSTLLIFTVSGRVITTTTTTSTSDLVSDGVHDGQGGILRLNPFVSAEEPEACEQSYGFLPCTNTALGNVFLILVYGYLMYLAATYLSAGSELLLEILGPGLVGGLLLPILGALPDAMLILVSGLSGSVDVAQDQVSVGMGLLAGSTVMLITVIWGTCIIVGKCDIENSVAIDNTDTKGFSLLGSGVSTDIWTSYSGMIMAVSVLPFIVVQFPQIMHSDSGRHVAVLLGLIVSVSLLITYCIYQVLQPKLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G337570`
TK1151 ID	TkA04G337570
OH-1004 ID	LXL04_037710
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G337570

Location Chr04:85300741-85307332 (-)

Description Similar to NCL: Sodium/calcium exchanger NCL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53210`	Possesses sodium/calcium exchanger (NCX) activity when expressed in a heterologous mammalian CHO-K1 cell system.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0212400`	May function as a sodium/calcium exchanger (NCX) and participate in the maintenance of calcium homeostasis.	No verified direct reference in this release
`Os02g0247800`	May function as a sodium/calcium exchanger (NCX) and participate in the maintenance of calcium homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037710 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006814 sodium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0055074 calcium ion homeostasis Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT1G53210

ath:AT1G55720

dosa:Os01g0212400

dosa:Os02g0247800

osa:4325568

osa:4328874

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.580

Rank 1 · TkA04G337570 · TK1151

Lysosome / Vacuole0.227

Rank 2 · TkA04G337570 · TK1151

Endoplasmic reticulum0.122

Rank 3 · TkA04G337570 · TK1151

Cytoplasm0.081

Rank 4 · TkA04G337570 · TK1151

Golgi apparatus0.051

Rank 5 · TkA04G337570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699Na_Ca_ex5-31 aa

PF22592FCaBP_EF-hand31-55 aa

PF05392COX7B77-89 aa

PF01699Na_Ca_ex79-255 aa

PF27081Lpg1689140-170 aa

PF05392COX7B148-165 aa

PF25932DUF7977201-237 aa

PF05392COX7B205-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G337570	`PF01699`	Na_Ca_ex	5	31	3.3e-21	76.5
TkA04G337570	`PF22592`	FCaBP_EF-hand	31	55	0.19	12.8
TkA04G337570	`PF05392`	COX7B	77	89	3.1	8.3
TkA04G337570	`PF01699`	Na_Ca_ex	79	255	3.3e-21	76.5
TkA04G337570	`PF27081`	Lpg1689	140	170	0.038	14.2
TkA04G337570	`PF05392`	COX7B	148	165	3.1	8.3
TkA04G337570	`PF25932`	DUF7977	201	237	1.6	9.4
TkA04G337570	`PF05392`	COX7B	205	220	3.1	8.3
TkA04G337570	`PF23564`	EF-hand_FSTL1	271	325	5.7e-06	27.4
TkA04G337570	`PF13499`	EF-hand_7	298	363	1.2e-10	42.3
TkA04G337570	`PF10591`	SPARC_Ca_bdg	298	362	0.13	13.3
TkA04G337570	`PF13405`	EF-hand_6	301	324	3.4e-06	27.0
TkA04G337570	`PF00036`	EF-hand_1	302	324	6.6e-08	32.3
TkA04G337570	`PF13202`	EF-hand_5	302	324	0.02	15.1
TkA04G337570	`PF22592`	FCaBP_EF-hand	302	322	0.19	12.8
TkA04G337570	`PF30624`	EF_SSP120	304	361	0.28	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L636`	Arabidopsis thaliana	sp\|Q8L636\|NCL_ARATH Sodium/calcium exchanger NCL	63.400%	Swiss-Prot	High
`Q5QNI2`	Oryza sativa subsp. japonica	sp\|Q5QNI2\|NCL1_ORYSJ Sodium/calcium exchanger NCL1	62.100%	Swiss-Prot	High
`Q6K3R5`	Oryza sativa subsp. japonica	sp\|Q6K3R5\|NCL2_ORYSJ Sodium/calcium exchanger NCL2	60.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card