TkA04G336500 | RubberDandelionOmics

Gene overview

TkA04G336500

Reference: TK1151 Chr: Chr04 Coordinates: 85008821-85011799 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1957 bp · TkA04G336500|TK1151|cDNA

GTCCTCACCAGTCACTAATCACAAGTAGGCCGGCCTTTTATCTTTTCGTTCTAACAGTCCAAGTAGGGCGTGGAATAGAAGAAAAAAAAATCATTCGTTAGCAACTATAATCCGATAATCACGATTCCATGAATAAATTCCGTTCTTTCTTTCACGGAATCACGCCTATCAAACTATCAATCAACCGATCGTTTTGAATTGCCAATTACTCTGCTTTCTGATTTAATAACAAATCTCGTTCATAGCTCTACATCCAAATC...

CDS

Download CDS FASTA

1080 bp · TkA04G336500|TK1151|CDS

ATGTCAAGTTATCTATGCGAAGAGTTGGTTGTTGAAATTTTTTCAAGATTACCGCCCAAATCCCTCCTCCGATTTAGATCGCTTTCAAAATCGTTATATAATTGTATTTCTAGCCCTAGTTTCATACGCATTCATACTTTCCGATCCACACAAAAAATCCTTTTCAAACATCGTTACAAAAATAAGAAAACACCCTTTTATACATTACATGGAGAGGACCAGTTGCCATTGTCTCCCAATGATGGATACATTGGTATAAC...

Protein

Download Protein FASTA

359 aa · TkA04G336500|TK1151|PROTEIN

MSSYLCEELVVEIFSRLPPKSLLRFRSLSKSLYNCISSPSFIRIHTFRSTQKILFKHRYKNKKTPFYTLHGEDQLPLSPNDGYIGITTIPCPSSSFNKIVGSCNGIFCLQSRNSLILWNPSITRKLSLSEYPRRFEWLEAFGFGFDPISEDYKIIMISYARDTSLFYAVKTGAWCEIASPKPRCLDVSPCTCSLEGVWHWPVRYRIESEEMRLTCSILTFNLSTHVFGMIPLPTPASDWMTTGLTTIQGSLALISYHMKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G336500`
TK1151 ID	TkA04G336500
OH-1004 ID	LXL04_039559
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.700
Protein coverage (%)	TK1151 73.538 / OH-1004 75.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G336500

Location Chr04:85008821-85011799 (+)

Description Similar to At3g16210: Putative F-box protein At3g16210

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47790`	Putative F-box protein At1g47790.	No verified direct reference in this release
`At5g18160`	F-box protein At5g18160.	No verified direct reference in this release
`At1g26510`	Putative F-box protein At1g26510.	No verified direct reference in this release
`At4g21240`	Putative F-box protein At4g21240.	No verified direct reference in this release
`At3g07870`	F-box protein At3g07870.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039559 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference

ath:AT3G16210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.647

Rank 1 · TkA04G336500 · TK1151

Nucleus0.406

Rank 2 · TkA04G336500 · TK1151

Cell membrane0.104

Rank 3 · TkA04G336500 · TK1151

Endoplasmic reticulum0.069

Rank 4 · TkA04G336500 · TK1151

Lysosome / Vacuole0.034

Rank 5 · TkA04G336500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box5-42 aa

PF12937F-box-like7-41 aa

PF08268FBA_388-327 aa

PF24750b-prop_At3g26010-like152-281 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G336500	`PF00646`	F-box	5	42	2.5e-09	37.4
TkA04G336500	`PF12937`	F-box-like	7	41	1.7e-05	25.2
TkA04G336500	`PF08268`	FBA_3	88	327	6.2e-15	55.7
TkA04G336500	`PF24750`	b-prop_At3g26010-like	152	281	0.0065	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZF8`	Arabidopsis thaliana	sp\|Q9FZF8\|FB44_ARATH Putative F-box protein At1g47790	28.800%	Swiss-Prot	Low
`Q9FK54`	Arabidopsis thaliana	sp\|Q9FK54\|FB260_ARATH F-box protein At5g18160	23.400%	Swiss-Prot	Low
`Q9FZD5`	Arabidopsis thaliana	sp\|Q9FZD5\|FB307_ARATH Putative F-box protein At1g26510	27.600%	Swiss-Prot	Low
`O49565`	Arabidopsis thaliana	sp\|O49565\|FB239_ARATH Putative F-box protein At4g21240	28.200%	Swiss-Prot	Low
`Q9SFC7`	Arabidopsis thaliana	sp\|Q9SFC7\|FB135_ARATH F-box protein At3g07870	27.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card