TkA04G333970 | RubberDandelionOmics

Gene overview

TkA04G333970

Reference: TK1151 Chr: Chr04 Coordinates: 84334485-84335938 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1329 bp · TkA04G333970|TK1151|cDNA

CGGCGACCGTCACCTTTCTAAAACTTTCCGAGTAAGTTGACTTTGTTTGTTGCTGAACAGCTGAAATTCATAGCACATTACGATTTTCTTTTTAATGAACTGTAGTATGAATTACGAATATGTTGAAATTGGAGATTAGTTTTACAATCGATTTTGTCGAATGAAATTTTGCTTTGATTCGAGTTGATTTGTTCTGCAAATCTGATTTTAAAAAGATGAAGATGGCGGTGAAATTAATGAGTCATAATCCACTGCTTCGT...

CDS

Download CDS FASTA

567 bp · TkA04G333970|TK1151|CDS

ATGAAGATGGCGGTGAAATTAATGAGTCATAATCCACTGCTTCGTCGTGTCAGTTTTACAGCATGTCGAATCTCCCACCGCCGCCTCTCTGTCGGCAACTCTTCATATATAACGCCGGCGAAAACCAAAATTCAACCACCAGCAGTTTCCGTCGTATGTAAGATGCAGGAAAAACGTGATCTGAGTTCACCTACAGTCGAAACCGGAAAAGGTAGGAGCAGGATAAACAAGAAGATAACACATGGCTACCATTCTGTTGA...

Protein

Download Protein FASTA

188 aa · TkA04G333970|TK1151|PROTEIN

MKMAVKLMSHNPLLRRVSFTACRISHRRLSVGNSSYITPAKTKIQPPAVSVVCKMQEKRDLSSPTVETGKGRSRINKKITHGYHSVEGKQSHPMEDYVFAQFKQVDGNELGLFAVFDGHLSQKVPDYLRSHLFDNIINQVQYLPLYIFNITIPPLLTVITLYVDISMTFGRSRRKRLSERMNSQTLRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G333970`
TK1151 ID	TkA04G333970
OH-1004 ID	LXL04_037683
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 73.936 / OH-1004 42.378 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G333970

Location Chr04:84334485-84335938 (+)

Description Similar to At3g15260: Probable protein phosphatase 2C 39

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15260`	Probable protein phosphatase 2C 39.	No verified direct reference in this release
`At4g28400`	Probable protein phosphatase 2C 58.	No verified direct reference in this release
`At2g20630`	May be involved in defense signaling.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0507000`	Probable protein phosphatase 2C 62.	No verified direct reference in this release
`Os04g0609600`	Probable protein phosphatase 2C 44.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037683 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G20630

ath:AT3G15260

ath:AT4G28400

dosa:Os04g0609600

dosa:Os07g0507000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.873

Rank 1 · TkA04G333970 · TK1151

Nucleus0.079

Rank 2 · TkA04G333970 · TK1151

Cytoplasm0.074

Rank 3 · TkA04G333970 · TK1151

Plastid0.060

Rank 4 · TkA04G333970 · TK1151

Cell membrane0.022

Rank 5 · TkA04G333970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C90-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G333970	`PF00481`	PP2C	90	144	0.075	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDA7`	Arabidopsis thaliana	sp\|Q9LDA7\|P2C39_ARATH Probable protein phosphatase 2C 39	67.100%	Swiss-Prot	High
`Q93YW5`	Arabidopsis thaliana	sp\|Q93YW5\|P2C58_ARATH Probable protein phosphatase 2C 58	62.000%	Swiss-Prot	High
`Q9SIU8`	Arabidopsis thaliana	sp\|Q9SIU8\|P2C20_ARATH Probable protein phosphatase 2C 20	61.400%	Swiss-Prot	High
`Q0D673`	Oryza sativa subsp. japonica	sp\|Q0D673\|P2C62_ORYSJ Probable protein phosphatase 2C 62	65.100%	Swiss-Prot	High
`Q0JAA0`	Oryza sativa subsp. japonica	sp\|Q0JAA0\|P2C44_ORYSJ Probable protein phosphatase 2C 44	60.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card