TkA04G330400 | RubberDandelionOmics

Gene overview

TkA04G330400

Reference: TK1151 Chr: Chr04 Coordinates: 83413491-83415089 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1405 bp · TkA04G330400|TK1151|cDNA

CTTAACCGCAATTAACCCCACGCTAAACACTGTAAGAAAAGGACGACCGTACTTATCTCTGTAAATCTCCCTATAAAAAGCCATCGGCTTTCAAGTTTTTTGAAAAAAAGAGAATTTTCTTTAATCATCTCGAATTCTCTCTAACAAATATCGAACAATGGGTTTACCAGTAACGGATCCGATGACTCAACTGAGTTTACCACCTGGGTTTCGGTTTTTTCCGACCGATGAAGAGCTGCTGGTGCAGTACCTGTGCCGTA...

CDS

Download CDS FASTA

1014 bp · TkA04G330400|TK1151|CDS

ATGGGTTTACCAGTAACGGATCCGATGACTCAACTGAGTTTACCACCTGGGTTTCGGTTTTTTCCGACCGATGAAGAGCTGCTGGTGCAGTACCTGTGCCGTAAAGTCGCCGGACATGATTTCTCGCTTCAGATCATAGCGGATATTGATTTGTACAAATTTGATCCATGGGAGCTTCCAAGTAAGGCGATGTTTGGGGATAAAGAATGGTACTTTTTTAGTCCAAGAGATCGAAAGTATCCAAATGGGTCTCGACCCAA...

Protein

Download Protein FASTA

337 aa · TkA04G330400|TK1151|PROTEIN

MGLPVTDPMTQLSLPPGFRFFPTDEELLVQYLCRKVAGHDFSLQIIADIDLYKFDPWELPSKAMFGDKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITTGGRRVGIKKALVFYVGKAPKGNKTNWIMHEYRLSEPQRKNGSSRLDDWVLCRIYKKNSSAQKHISGGAPTTEQSHGSSSSSSSQFDDVLESLPEIEDRFFNLPRINSVKNFQQEDQKVNLQKYDSGNYDWASIAAFGMPEPLAGSQLNTTTAAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G330400`
TK1151 ID	TkA04G330400
OH-1004 ID	LXL04_037618
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G330400

Location Chr04:83413491-83415089 (-)

Description Similar to JA2L: NAC domain-containing protein JA2L

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27410`	May participate in stress responses and transcriptional regulation of associated genes.	Isolation and functional analysis of Arabidopsis stress-inducible NAC transcription factors that bind to a drought-responsive cis-element in the early responsive to dehydration stress 1 promoter.2004 · DOI: 10.1105/tpc.104.022699 Transcription factor RD26 is a key regulator of metabolic reprogramming during dark-induced senescence.2018 · DOI: 10.1111/nph.15127
`At1g52890`	Transcription factors that bind specifically to the 5'-CATGTG-3' motif.	No verified direct reference in this release
`At3g15500`	Transcription factors that bind specifically to the 5'-CATGTG-3' motif.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037618 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900055 regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G52890

ath:AT3G15500

ath:AT4G27410

sly:101248026

sly:543526

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkA04G330400 · TK1151

Cytoplasm0.094

Rank 2 · TkA04G330400 · TK1151

Endoplasmic reticulum0.041

Rank 3 · TkA04G330400 · TK1151

Cell membrane0.041

Rank 4 · TkA04G330400 · TK1151

Plastid0.017

Rank 5 · TkA04G330400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM15-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G330400	`PF02365`	NAM	15	139	2.8e-48	164.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VY3`	Arabidopsis thaliana	sp\|Q93VY3\|NAC72_ARATH NAC domain-containing protein 72	57.400%	Swiss-Prot	High
`Q9C932`	Arabidopsis thaliana	sp\|Q9C932\|NAC19_ARATH NAC domain-containing protein 19	66.700%	Swiss-Prot	High
`Q9LDY8`	Arabidopsis thaliana	sp\|Q9LDY8\|NAC55_ARATH NAC domain-containing protein 55	54.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card