TkA04G320410 | RubberDandelionOmics

Gene overview

TkA04G320410

Reference: TK1151 Chr: Chr04 Coordinates: 80936297-80936611 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · TkA04G320410|TK1151|cDNA

ATGGTGTGTGGAGTTTTGGGAATATTTGGAATGGCGGGAACTTTTAATCTGATGTTTGTATACGCGATGGAGTTGTTTCCAACAGTGGTTAGAAATGTTGCGGTCGGATGTGCGACACAAATGGCTCAGTTAGGTGTGATATTGGTGCCTTTCGTGGTGGTTACAGGCGGTAGTTTTCCGTTTATGATGTTTGGGGCATGTGGAATTATGGGAGGGATTCTTATATTATACCTACCGGAGACGTTAAACAAGCCATTGTA...

CDS

Download CDS FASTA

315 bp · TkA04G320410|TK1151|CDS

ATGGTGTGTGGAGTTTTGGGAATATTTGGAATGGCGGGAACTTTTAATCTGATGTTTGTATACGCGATGGAGTTGTTTCCAACAGTGGTTAGAAATGTTGCGGTCGGATGTGCGACACAAATGGCTCAGTTAGGTGTGATATTGGTGCCTTTCGTGGTGGTTACAGGCGGTAGTTTTCCGTTTATGATGTTTGGGGCATGTGGAATTATGGGAGGGATTCTTATATTATACCTACCGGAGACGTTAAACAAGCCATTGTA...

Protein

Download Protein FASTA

104 aa · TkA04G320410|TK1151|PROTEIN

MVCGVLGIFGMAGTFNLMFVYAMELFPTVVRNVAVGCATQMAQLGVILVPFVVVTGGSFPFMMFGACGIMGGILILYLPETLNKPLYDTMNGMVDGETEFLAVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G320410`
TK1151 ID	TkA04G320410
OH-1004 ID	LXL04_037535
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 21.138 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G320410

Location Chr04:80936297-80936611 (-)

Description Similar to OCT4: Organic cation/carnitine transporter 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20660`	High affinity carnitine transporter involved in the active cellular uptake of carnitine.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037535 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0010150 leaf senescence Biological Process

GO:0015839 cadaverine transport Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0015226 carnitine transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G16390

ath:AT1G73220

ath:AT1G79360

ath:AT3G20660

dme:Dmel_CG6331

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.284

Rank 1 · TkA04G320410 · TK1151

Endoplasmic reticulum0.231

Rank 2 · TkA04G320410 · TK1151

Lysosome / Vacuole0.194

Rank 3 · TkA04G320410 · TK1151

Cytoplasm0.150

Rank 4 · TkA04G320410 · TK1151

Golgi apparatus0.105

Rank 5 · TkA04G320410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_11-80 aa

PF00083Sugar_tr8-88 aa

PF19851DUF632645-84 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G320410	`PF07690`	MFS_1	1	80	0.01	15.5
TkA04G320410	`PF00083`	Sugar_tr	8	88	0.00052	19.7
TkA04G320410	`PF19851`	DUF6326	45	84	0.011	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHQ6`	Arabidopsis thaliana	sp\|Q9LHQ6\|OCT4_ARATH Organic cation/carnitine transporter 4	69.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card