TkA04G318610 | RubberDandelionOmics

Gene overview

TkA04G318610

Reference: TK1151 Chr: Chr04 Coordinates: 80461697-80465596 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

646 bp · TkA04G318610|TK1151|cDNA

CATCTCCACGCACCATCACATCCTCTCCATATTTTATTTTATTTTCGTTATTTAAATAATTTAAACATTTTAATTATTCTACACTCAACGTCACCTTCCGACATTTATAAATACATCTCCCAACTTATTTTACCACCAAAACTCTCCAAAATCTTTCCGAAAAAAGCAAAATTCATGAAGCCAAATTTAGCACCGTTGTATCTGTTGTTAACAGCATCATCGATATTTTTTAGATCGGAATCTACAAGCAGAGCTGATTT...

CDS

Download CDS FASTA

1704 bp · TkA04G318610|TK1151|CDS

CATCTCCACGCACCATCACATCCTCTCCATATTTTATTTTATTTTCGTTATTTAAATAATTTAAACATTTTAATTATTCTACACTCAACGTCACCTTCCGACATTTATAAATACATCTCCCAACTTATTTTACCACCAAAACTCTCCAAAATCTTTCCGAAAAAAGCAAAATTCATGAAGCCAAATTTAGCACCGTTGTATCTGTTGTTAACAGCATCATCGATATTTTTTAGATCGGAATCTACAAGCAGAGCTGATTT...

Protein

Download Protein FASTA

567 aa · TkA04G318610|TK1151|PROTEIN

HLHAPSHPLHILFYFRYLNNLNILIILHSTSPSDIYKYISQLILPPKLSKIFPKKAKFMKPNLAPLYLLLTASSIFFRSESTSRADFPHGFTFGTASSAFQFEGAVDEGNKGDSIWDTFSRLPGRILDFSNADEAVDQYHRFKDDIELMKNLGMDAYRFSISWSRIFPNGTGKPNPQGIKYYNNLIDSLLEKGIEPYATLYHWDLPQTLEDKYEGWLNNQIIEDFKHFAFTCFEEFGDRVKNWITFNEPHGFAIQGYDYG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G318610`
TK1151 ID	TkA04G318610
OH-1004 ID	LXL04_037536
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 89.771 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G318610

Location Chr04:80461697-80465596 (+)

Description Similar to BGLU41: Putative beta-glucosidase 41

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54570`	Putative beta-glucosidase 41.	No verified direct reference in this release
`At1g26560`	Beta-glucosidase 40.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0683300`	Beta-glucosidase 25.	No verified direct reference in this release
`Os10g0323500`	Beta-glucosidase 34.	No verified direct reference in this release
`Os03g0212800`	Hydrolyzes glycosides, oligosaccharides and hydrophobic glycosides.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037536 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008422 beta-glucosidase activity Molecular Function

GO:0016798 hydrolase activity, acting on glycosyl bonds Molecular Function

GO:0033907 beta-D-fucosidase activity Molecular Function

GO:0042973 glucan endo-1,3-beta-D-glucosidase activity Molecular Function

GO:0047782 coniferin beta-glucosidase activity Molecular Function

GO:0080079 cellobiose glucosidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26560

ath:AT5G54570

dosa:Os03g0212800

dosa:Os06g0683300

dosa:Os10g0323500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.300

Rank 1 · TkA04G318610 · TK1151

Endoplasmic reticulum0.245

Rank 2 · TkA04G318610 · TK1151

Plastid0.207

Rank 3 · TkA04G318610 · TK1151

Cytoplasm0.083

Rank 4 · TkA04G318610 · TK1151

Cell membrane0.055

Rank 5 · TkA04G318610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232Glyco_hydro_185-558 aa

PF00150Cellulase141-251 aa

PF00150Cellulase457-475 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G318610	`PF00232`	Glyco_hydro_1	85	558	1.4e-160	535.5
TkA04G318610	`PF00150`	Cellulase	141	251	0.031	14.5
TkA04G318610	`PF00150`	Cellulase	457	475	0.031	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIU7`	Arabidopsis thaliana	sp\|Q9FIU7\|BGL41_ARATH Putative beta-glucosidase 41	71.800%	Swiss-Prot	High
`Q9FZE0`	Arabidopsis thaliana	sp\|Q9FZE0\|BGL40_ARATH Beta-glucosidase 40	62.000%	Swiss-Prot	High
`Q0DA21`	Oryza sativa subsp. japonica	sp\|Q0DA21\|BGL25_ORYSJ Beta-glucosidase 25	69.400%	Swiss-Prot	High
`Q339X2`	Oryza sativa subsp. japonica	sp\|Q339X2\|BGL34_ORYSJ Beta-glucosidase 34	61.000%	Swiss-Prot	High
`Q8L7J2`	Oryza sativa subsp. japonica	sp\|Q8L7J2\|BGL06_ORYSJ Beta-glucosidase 6	58.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card