Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1248 bp · TkA04G318590|TK1151|cDNA
ATGTCTATGGCGCCTAGGAAAACGAAATTTCAATCGACGTCTAGAAACACAGAGATCTGTTGGCGCTGCGTATATGTTTCTCTAAGTTCATTTAGTGATACCGTTAGTGTGCTTGCTTTCACTCAGGCAACAGAGCAACAAGAACCACCGCAACGACTAACTGCTAACAAGGTTGACCCTGTTAGACTTGATGATCAATTTGGGAATAATAAGGGGGAACCATCACCAATATCGAGTTTCTCTATGGGTAATTTTGGGGC...
732 bp · TkA04G318590|TK1151|CDS
ATGTCTATGGCGCCTAGGAAAACGAAATTTCAATCGACGTCTAGAAACACAGAGATCTGTTGGCGCTGCGTATATGTTTCTCTAAGTTCATTTAGTGATACCGTTAGTGTGCTTGCTTTCACTCAGGCAACAGAGCAACAAGAACCACCGCAACGACTAACTGCTAACAAGGTTGACCCTGTTAGACTTGATGATCAATTTGGGAATAATAAGGGGGAACCATCACCAATATCGAGTTTCTCTATGGGTAATTTTGGGGC...
Protein
Download Protein FASTA243 aa · TkA04G318590|TK1151|PROTEIN
MSMAPRKTKFQSTSRNTEICWRCVYVSLSSFSDTVSVLAFTQATEQQEPPQRLTANKVDPVRLDDQFGNNKGEPSPISSFSMGNFGAFGTPMEREIVRKNVQVNYIDGSDDKKWSKRVFSWTKKLEPNNKKVFGNHSFRPNQRKVLNATMSGNDVFVLMPTGGEKSLTYQLLALICPGVTLVISPLVSLIQDQIMHLLQKHSTLTSYETEKIFVARFTFLEIPLIWTTATGIFQVNTKSSLSL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G318590 |
|---|---|
| TK1151 ID | TkA04G318590 |
| OH-1004 ID | LXL04_011240 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 85.500 |
| Protein coverage (%) | TK1151 65.432 / OH-1004 83.684Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G318590 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:80452434-80455740 (-) | |||||||||
| Description | Similar to RECQL4A: ATP-dependent DNA helicase Q-like 4A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006974 DNA damage response Biological Process GO:0031297 replication fork processing Biological Process GO:0051276 chromosome organization Biological Process GO:0070417 cellular response to cold Biological Process GO:0071215 cellular response to abscisic acid stimulus Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G10930 ath:AT1G60930 hsa:5965 pon:100171554 rno:312824 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF17518DUF544395-175 aaPF00270DEAD139-203 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G318590 | PF17518 | DUF5443 | 95 | 175 | 0.017 | 14.9 |
| TkA04G318590 | PF00270 | DEAD | 139 | 203 | 2.1e-08 | 34.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.