TkA04G314640 | RubberDandelionOmics

Gene overview

TkA04G314640

Reference: TK1151 Chr: Chr04 Coordinates: 79303871-79307068 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1784 bp · TkA04G314640|TK1151|cDNA

CAAAACCATCTTCTCTCATATCCACCCAAAACATAGTATTACCAAAACCAAAACAAAATCAAATCACGTTAAATCTTAAGCCTTTTTACAGTTAGGGTTCGGTTTCTTCTTTTGGTAAAAAATGCAGTTACATATATCACCAAGTTTACGACACGTTACACTATTGCCACCAAAAGGTGTTAGAGAGTTCATAAAAGTTAAGGTCGGGTCTCGAAGGTTGTCTTACAGAATGTTGTTTTATTCACTTTTGTTATTCACGT...

CDS

Download CDS FASTA

1611 bp · TkA04G314640|TK1151|CDS

ATGCAGTTACATATATCACCAAGTTTACGACACGTTACACTATTGCCACCAAAAGGTGTTAGAGAGTTCATAAAAGTTAAGGTCGGGTCTCGAAGGTTGTCTTACAGAATGTTGTTTTATTCACTTTTGTTATTCACGTTTCTTCTTAGATTTATATATGTGTTTAGTACCGTTGACACCATCGATGATCAAACCAAATGCTCGAGTGTTGGTTGTTCGGGGAAAAGATTGGCATCCGGTATAATAAGGGGAAGGAGCCT...

Protein

Download Protein FASTA

536 aa · TkA04G314640|TK1151|PROTEIN

MQLHISPSLRHVTLLPPKGVREFIKVKVGSRRLSYRMLFYSLLLFTFLLRFIYVFSTVDTIDDQTKCSSVGCSGKRLASGIIRGRSLQSNSAVPRVIYQILEDRSNEDEIVGGPEIPQTLEEFVTSMKGSNKLDAKTFAIKLKSMVTLLEKRTRTAKIQEYLYRHVASSGIPKQLHCLALRLAHEHATNAAARLQLPSPELIPALVNNSYFHFVLASDNILAASVVATSLVYNSLRPETVVIHIITDRKTYAPMQAWFSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G314640`
TK1151 ID	TkA04G314640
OH-1004 ID	LXL04_037511
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G314640

Location Chr04:79303871-79307068 (+)

Description Similar to GAUT12: Probable galacturonosyltransferase 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54690`	Involved in pectin assembly and/or distribution, and in the synthesis of secondary wall glucuronoxylan.	The Arabidopsis irregular xylem8 mutant is deficient in glucuronoxylan and homogalacturonan, which are essential for secondary cell wall integrity.2007 · DOI: 10.1105/tpc.106.047720 Arabidopsis irregular xylem8 and irregular xylem9: implications for the complexity of glucuronoxylan biosynthesis.2007 · DOI: 10.1105/tpc.106.049320 Comparison of five xylan synthesis mutants reveals new insight into the mechanisms of xylan synthesis.2007 · DOI: 10.1111/j.1365-313x.2007.03307.x
`At5g15470`	May be involved in pectin and/or xylans biosynthesis in cell walls (By similarity).	Arabidopsis galacturonosyltransferase (GAUT) 13 and GAUT14 have redundant functions in pollen tube growth.2013 · DOI: 10.1093/mp/sst084
`At3g01040`	May be involved in pectin and/or xylans biosynthesis in cell walls (By similarity).	Arabidopsis galacturonosyltransferase (GAUT) 13 and GAUT14 have redundant functions in pollen tube growth.2013 · DOI: 10.1093/mp/sst084
`At3g58790`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g02350`	May be involved in pectin synthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037511 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010413 glucuronoxylan metabolic process Biological Process

GO:0010417 glucuronoxylan biosynthetic process Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT3G01040

ath:AT3G58790

ath:AT5G15470

ath:AT5G47780

ath:AT5G54690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.821

Rank 1 · TkA04G314640 · TK1151

Endoplasmic reticulum0.089

Rank 2 · TkA04G314640 · TK1151

Cytoplasm0.061

Rank 3 · TkA04G314640 · TK1151

Cell membrane0.055

Rank 4 · TkA04G314640 · TK1151

Extracellular0.049

Rank 5 · TkA04G314640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01501Glyco_transf_8210-510 aa

PF18404Glyco_transf_24327-443 aa

PF22261GPR128_GAIN_subdom_B386-413 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G314640	`PF01501`	Glyco_transf_8	210	510	4.9e-70	236.7
TkA04G314640	`PF18404`	Glyco_transf_24	327	443	8.8e-06	26.0
TkA04G314640	`PF22261`	GPR128_GAIN_subdom_B	386	413	0.26	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FH36`	Arabidopsis thaliana	sp\|Q9FH36\|GAUTC_ARATH Probable galacturonosyltransferase 12	74.100%	Swiss-Prot	High
`Q8GWT1`	Arabidopsis thaliana	sp\|Q8GWT1\|GAUTE_ARATH Probable galacturonosyltransferase 14	53.200%	Swiss-Prot	High
`Q0WV13`	Arabidopsis thaliana	sp\|Q0WV13\|GAUTD_ARATH Probable galacturonosyltransferase 13	53.900%	Swiss-Prot	High
`Q8L4B0`	Arabidopsis thaliana	sp\|Q8L4B0\|GAUTF_ARATH Probable galacturonosyltransferase 15	41.700%	Swiss-Prot	Medium
`Q9FWA4`	Arabidopsis thaliana	sp\|Q9FWA4\|GAUT9_ARATH Probable galacturonosyltransferase 9	42.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card