TkA04G313940 | RubberDandelionOmics

Gene overview

TkA04G313940

Reference: TK1151 Chr: Chr04 Coordinates: 79064459-79068062 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1906 bp · TkA04G313940|TK1151|cDNA

AAGAAATCCTCCCTTTGCATATCGTAAACAACCATTTTCAAGAGGTTTTTGATAGCTATCAAAATATGGCTAACATCTTCAACTTTTACTATGCTTTCCCGTTCATATTTCTTCATGTTCTTCTAACCATGTTCACTCCTTTTGGAGTTGTTAATGGTGGCACTCCTACCACTACCTTTTCAGTATGTAGTCAAACCCCTCATCCCGAAATTTGCACTTCTTTGATTGGAAAGACTAGTAAAGAAATTACCCCATTTGAG...

CDS

Download CDS FASTA

1608 bp · TkA04G313940|TK1151|CDS

ATGGCTAACATCTTCAACTTTTACTATGCTTTCCCGTTCATATTTCTTCATGTTCTTCTAACCATGTTCACTCCTTTTGGAGTTGTTAATGGTGGCACTCCTACCACTACCTTTTCAGTATGTAGTCAAACCCCTCATCCCGAAATTTGCACTTCTTTGATTGGAAAGACTAGTAAAGAAATTACCCCATTTGAGGTTCATGAAACGACCTTTGGGTCTACTTTGGCTCAAGCCGAGCATGCATATAAGCTTGTTTTGGC...

Protein

Download Protein FASTA

535 aa · TkA04G313940|TK1151|PROTEIN

MANIFNFYYAFPFIFLHVLLTMFTPFGVVNGGTPTTTFSVCSQTPHPEICTSLIGKTSKEITPFEVHETTFGSTLAQAEHAYKLVLAMDLSSFEPRARSAWADCLELYEDSVYQINRSLGSTNSHDIQTWLSSASTNHETCQNGFLDFNLSSHLQTFQTSLSGFSKYLTNSLAINKAITLPHVSYSKQLKGRRLIETKDFPNWLSKSDRKLLATPSSATSPNIVVAQDGSGDYKTISEAISDVPKLRNGNSRLVIHVKAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G313940`
TK1151 ID	TkA04G313940
OH-1004 ID	LXL04_021202
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G313940

Location Chr04:79064459-79068062 (-)

Description Similar to PME6: Probable pectinesterase/pectinesterase inhibitor 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23200`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g53370`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At2g45220`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021202 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

KEGG gene cross-reference

ath:AT1G23200

ath:AT2G45220

ath:AT3G49220

ath:AT5G53370

cit:102577945

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.598

Rank 1 · TkA04G313940 · TK1151

Cell membrane0.125

Rank 2 · TkA04G313940 · TK1151

Lysosome / Vacuole0.103

Rank 3 · TkA04G313940 · TK1151

Cytoplasm0.096

Rank 4 · TkA04G313940 · TK1151

Endoplasmic reticulum0.094

Rank 5 · TkA04G313940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04043PMEI39-174 aa

PF01095Pectinesterase222-520 aa

PF00245Alk_phosphatase275-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G313940	`PF04043`	PMEI	39	174	2e-25	90.4
TkA04G313940	`PF01095`	Pectinesterase	222	520	1.6e-140	467.8
TkA04G313940	`PF00245`	Alk_phosphatase	275	356	0.11	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49298`	Arabidopsis thaliana	sp\|O49298\|PME6_ARATH Probable pectinesterase/pectinesterase inhibitor 6	52.300%	Swiss-Prot	High
`Q9FK05`	Arabidopsis thaliana	sp\|Q9FK05\|PME61_ARATH Probable pectinesterase/pectinesterase inhibitor 61	48.700%	Swiss-Prot	Medium
`O22149`	Arabidopsis thaliana	sp\|O22149\|PME17_ARATH Probable pectinesterase/pectinesterase inhibitor 17	50.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card