TkA04G313290 | RubberDandelionOmics

Gene overview

TkA04G313290

Reference: TK1151 Chr: Chr04 Coordinates: 78890190-78894773 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3477 bp · TkA04G313290|TK1151|cDNA

ATGGCTGTTACAGACAACGTCGTGGACAAATATTGGATGGGAGCGAGTAGAAACACACAAACATTTATCAAGGGTGTTGATGCTTTCTTGGAATATGCAGTTTCCAATTACAAGAATGTTCACAATACCAATCCCCAGAAACATTCCCAACAAACCATACTCATTCCATGTCCATGTATCCGTTGTGTGAACCACTTACCTCATTCGGTGGAAGTAGTACGTGATCACTTATTCACATATGGTATTGATGAAACCTACAC...

CDS

Download CDS FASTA

3477 bp · TkA04G313290|TK1151|CDS

ATGGCTGTTACAGACAACGTCGTGGACAAATATTGGATGGGAGCGAGTAGAAACACACAAACATTTATCAAGGGTGTTGATGCTTTCTTGGAATATGCAGTTTCCAATTACAAGAATGTTCACAATACCAATCCCCAGAAACATTCCCAACAAACCATACTCATTCCATGTCCATGTATCCGTTGTGTGAACCACTTACCTCATTCGGTGGAAGTAGTACGTGATCACTTATTCACATATGGTATTGATGAAACCTACAC...

Protein

Download Protein FASTA

1158 aa · TkA04G313290|TK1151|PROTEIN

MAVTDNVVDKYWMGASRNTQTFIKGVDAFLEYAVSNYKNVHNTNPQKHSQQTILIPCPCIRCVNHLPHSVEVVRDHLFTYGIDETYTNWTYHGEKEFEPLPYVVDEEFPMDTFFVDDSMDYTSEKPTDAAETIDLVGATGENFMDDPIKFRDLLEDAEKPLYEGCHSFTKLSAVIQLLNLKSKYGVSDKFYNELLPLLKRMFPEGNEMYPSTYEAKKAFKQMGSGYEKIHACANRCILYRKEFEHLTTCPTCGNSRWKVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G313290`
TK1151 ID	TkA04G313290
OH-1004 ID	LXL04_039589
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.500
Protein coverage (%)	TK1151 90.069 / OH-1004 70.091 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G313290`
Location	Chr04:78890190-78894773 (+)
Description	Similar to AGDP1: Protein AGENET DOMAIN (AGD)-CONTAINING P1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039589` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process GO:0000775 chromosome, centromeric region Cellular Component GO:0000792 heterochromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0042393 histone binding Molecular Function GO:0140566 histone reader activity Molecular Function
KEGG gene cross-reference	ath:AT1G09320 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.872

Rank 1 · TkA04G313290 · TK1151

Cytoplasm0.222

Rank 2 · TkA04G313290 · TK1151

Mitochondrion0.022

Rank 3 · TkA04G313290 · TK1151

Extracellular0.020

Rank 4 · TkA04G313290 · TK1151

Cell membrane0.017

Rank 5 · TkA04G313290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13963Transpos_assoc10-94 aa

PF13963Transpos_assoc248-259 aa

PF02992Transposase_21309-515 aa

PF06869DUF1258333-387 aa

PF08283Gemini_AL1_M476-536 aa

PF13960DUF4218678-783 aa

PF08283Gemini_AL1_M943-984 aa

PF13952DUF4216962-1026 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G313290	`PF13963`	Transpos_assoc	10	94	8.1e-16	58.7
TkA04G313290	`PF13963`	Transpos_assoc	248	259	8.1e-16	58.7
TkA04G313290	`PF02992`	Transposase_21	309	515	3.6e-83	278.7
TkA04G313290	`PF06869`	DUF1258	333	387	0.014	15.7
TkA04G313290	`PF08283`	Gemini_AL1_M	476	536	0.018	15.8
TkA04G313290	`PF13960`	DUF4218	678	783	3.4e-39	133.9
TkA04G313290	`PF08283`	Gemini_AL1_M	943	984	0.018	15.8
TkA04G313290	`PF13952`	DUF4216	962	1026	1.8e-18	67.6
TkA04G313290	`PF30832`	CTC1_6th	1121	1143	0.095	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card