TkA04G307850 | RubberDandelionOmics

Gene overview

TkA04G307850

Reference: TK1151 Chr: Chr04 Coordinates: 77667342-77673603 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2582 bp · TkA04G307850|TK1151|cDNA

ATTCAATCACCTTGCTCGAAAAATTCAATAAACCCTAGCTGCAACCCTACCGCCTAAAACCCCAGCTCACGTTACCCAAATGAACAAAATTTAACATAAAACAATCTAAAACCCAACGATTTCAACCACTATCTGAAACCCTAACAAGTAATCTCCGAGTGAAACAATGAAGAAACCAAAATCCAAGCAGTCGCGTATACAAAACCGCACATCGGAGGTTCAAGAGATTGAATTGCTCGAGAAATGGATAGAATTTGGGA...

CDS

Download CDS FASTA

2229 bp · TkA04G307850|TK1151|CDS

ATGAAGAAACCAAAATCCAAGCAGTCGCGTATACAAAACCGCACATCGGAGGTTCAAGAGATTGAATTGCTCGAGAAATGGATAGAATTTGGGAAACCGGAATCAGGTTCCAATCCATTATCCCTCCCTCCGCTGCCGGCCAAGTCCCCCATCGGCCGTATCGATGAAAATACCTACTCTCAGTACGCAGGGTGCACGAAGTTCCAGCAGTTACCTATTTCAAAGAATTCAAAAGATGCATTGCGCCAATCTGGGTATAA...

Protein

Download Protein FASTA

742 aa · TkA04G307850|TK1151|PROTEIN

MKKPKSKQSRIQNRTSEVQEIELLEKWIEFGKPESGSNPLSLPPLPAKSPIGRIDENTYSQYAGCTKFQQLPISKNSKDALRQSGYKDMTNIQRASLPHALCGRDILGAAKTGSGKTLAFIVPVLEKLYKARWGREDGVGSIIMSPTRELADQIFGVLKSVGKHHGFSVGLLIGGNEYDEEKDLVNGMNILICTPGRLLKHMDTTPNFDCSELQVLVLDEADRILDSGFRKEVNAIISQLPKHRQTLLFSATQTKSVKDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G307850`
TK1151 ID	TkA04G307850
OH-1004 ID	LXL04_037433
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G307850

Location Chr04:77667342-77673603 (+)

Description Similar to RH32: DEAD-box ATP-dependent RNA helicase 32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54910`	DEAD-box ATP-dependent RNA helicase 32.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0517000`	DEAD-box ATP-dependent RNA helicase 32.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037433 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0032040 small-subunit processome Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

afm:AFUA_6G11070

ath:AT5G54910

ddi:DDB_G0284017

dosa:Os07g0517000

ncr:NCU04439

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.943

Rank 1 · TkA04G307850 · TK1151

Cytoplasm0.125

Rank 2 · TkA04G307850 · TK1151

Mitochondrion0.022

Rank 3 · TkA04G307850 · TK1151

Cell membrane0.017

Rank 4 · TkA04G307850 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA04G307850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270DEAD90-260 aa

PF04851ResIII109-252 aa

PF00271Helicase_C135-188 aa

PF00271Helicase_C241-258 aa

PF00271Helicase_C297-406 aa

PF13959CTE_SPB4460-506 aa

PF00270DEAD643-667 aa

PF04851ResIII662-669 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G307850	`PF00270`	DEAD	90	260	1.2e-46	159.2
TkA04G307850	`PF04851`	ResIII	109	252	3.2e-06	27.9
TkA04G307850	`PF00271`	Helicase_C	135	188	3.2e-24	86.0
TkA04G307850	`PF00271`	Helicase_C	241	258	3.2e-24	86.0
TkA04G307850	`PF00271`	Helicase_C	297	406	3.2e-24	86.0
TkA04G307850	`PF13959`	CTE_SPB4	460	506	1.5e-13	51.2
TkA04G307850	`PF00270`	DEAD	643	667	1.2e-46	159.2
TkA04G307850	`PF04851`	ResIII	662	669	3.2e-06	27.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFT9`	Arabidopsis thaliana	sp\|Q9FFT9\|RH32_ARATH DEAD-box ATP-dependent RNA helicase 32	56.900%	Swiss-Prot	High
`Q0D622`	Oryza sativa subsp. japonica	sp\|Q0D622\|RH32_ORYSJ DEAD-box ATP-dependent RNA helicase 32	49.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card