RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G288930
Reference: TK1151 Chr: Chr04 Coordinates: 73239734-73242452 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1173 bp · TkA04G288930|TK1151|cDNA

ATGAGTTGCTTGTTACGGGAATCGAACACCGCCCCATTGCCCTCAAAGGTGAACTTGGCGCACCAACTACGTACCCATCTTTGCAATACATTGCTTTTCTTAGGGTGGCAAAAGTATCGTCCAGTCATACCTCCAACTTGCGACTACATTCTAGTCAAACCTACAGTTCGTGGTCCGGCAATAGTTGTACCTCCAATCGCAGCTGCACTTCCAGTTTCAGTCGCAACAGCAGAACCTGTTGGAGCGTCAGGTTCTGGTCC...

CDS

Download CDS FASTA

1173 bp · TkA04G288930|TK1151|CDS

ATGAGTTGCTTGTTACGGGAATCGAACACCGCCCCATTGCCCTCAAAGGTGAACTTGGCGCACCAACTACGTACCCATCTTTGCAATACATTGCTTTTCTTAGGGTGGCAAAAGTATCGTCCAGTCATACCTCCAACTTGCGACTACATTCTAGTCAAACCTACAGTTCGTGGTCCGGCAATAGTTGTACCTCCAATCGCAGCTGCACTTCCAGTTTCAGTCGCAACAGCAGAACCTGTTGGAGCGTCAGGTTCTGGTCC...

Protein

Download Protein FASTA

390 aa · TkA04G288930|TK1151|PROTEIN

MSCLLRESNTAPLPSKVNLAHQLRTHLCNTLLFLGWQKYRPVIPPTCDYILVKPTVRGPAIVVPPIAAALPVSVATAEPVGASGSGPTTIVPPVAAAVPSPATAVPLIVAIVPGLATAVPALATAVPGATTAVPPVAPAVPDSSVGVPLGPTTVVPPVAAAVPGRRYSSSSSRSCTSWSDYSCTSGRTCTLWCGYNNTSSRSCTPGPTTAVLPVAPALCGVATAVPPVAAAVPGLGIVVPLVATVATGTAAIVLPPLALV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G288930
TK1151 IDTkA04G288930
OH-1004 IDLXL04_037368
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)96.600
Protein coverage (%)TK1151 7.436 / OH-1004 5.870
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G288930
LocationChr04:73239734-73242452 (-)
DescriptionSimilar to Zan: Zonadhesin
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037368 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane Biological Process
GO:0007155 cell adhesion Biological Process
GO:0007163 establishment or maintenance of cell polarity Biological Process
GO:0007339 binding of sperm to zona pellucida Biological Process
GO:0016055 Wnt signaling pathway Biological Process
GO:0045104 intermediate filament cytoskeleton organization Biological Process
GO:2000359 regulation of binding of sperm to zona pellucida Biological Process
GO:0005615 extracellular space Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0015629 actin cytoskeleton Cellular Component
GO:0015630 microtubule cytoskeleton Cellular Component
GO:0031012 extracellular matrix Cellular Component
KEGG gene cross-referenceNo functional description available
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.389
Rank 1 · TkA04G288930 · TK1151
Extracellular0.191
Rank 2 · TkA04G288930 · TK1151
Nucleus0.163
Rank 3 · TkA04G288930 · TK1151
Cell membrane0.104
Rank 4 · TkA04G288930 · TK1151
Mitochondrion0.077
Rank 5 · TkA04G288930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser