TkA04G272610 | RubberDandelionOmics

Gene overview

TkA04G272610

Reference: TK1151 Chr: Chr04 Coordinates: 68887655-68889552 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1299 bp · TkA04G272610|TK1151|cDNA

ATGGTTACACCGGAGTCTCAAATTGTTACTCAGCTTGAAGCAAGGATGGATGCGCAGGACGAGAAACTTGAAACATTATCCATTCAGATTAAAGATCTTACAGCTTCAGTAAACTCCATGAAAGAAGTTCTCAATGATCTGCCAAAATCTATGGAGAAAATGTTGGTAAGCTTCCAACAACCCGCATACAAGCATCGTGAACCTGTTATAGAGGCGGATAGATCACTGAAGCAGGAGGGAGATGTAGGAGAATACATAGA...

CDS

Download CDS FASTA

1299 bp · TkA04G272610|TK1151|CDS

ATGGTTACACCGGAGTCTCAAATTGTTACTCAGCTTGAAGCAAGGATGGATGCGCAGGACGAGAAACTTGAAACATTATCCATTCAGATTAAAGATCTTACAGCTTCAGTAAACTCCATGAAAGAAGTTCTCAATGATCTGCCAAAATCTATGGAGAAAATGTTGGTAAGCTTCCAACAACCCGCATACAAGCATCGTGAACCTGTTATAGAGGCGGATAGATCACTGAAGCAGGAGGGAGATGTAGGAGAATACATAGA...

Protein

Download Protein FASTA

432 aa · TkA04G272610|TK1151|PROTEIN

MVTPESQIVTQLEARMDAQDEKLETLSIQIKDLTASVNSMKEVLNDLPKSMEKMLVSFQQPAYKHREPVIEADRSLKQEGDVGEYIENFKALSAFIHDESEEQLLGMFIHGLHINIRNWVKFLSPTTCEKAMDLARNVAIATGATGECRVKTYQYMGSSGPNVYGMSSPRSPTHSTVKSNSQPQQLIRSNTPSGQPQLNSHNTSKLDTRLTKESRLFWELMSQSVKRQPYSIEINKFVKEAKSTSIITTEEIIGRSSTEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G272610`
TK1151 ID	TkA04G272610
OH-1004 ID	LXL04_037326
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G272610

Location Chr04:68887655-68889552 (-)

Description Similar to HISN4: Imidazole glycerol phosphate synthase hisHF, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26900`	IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037326 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000105 L-histidine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0000107 imidazoleglycerol-phosphate synthase activity Molecular Function

GO:0004359 glutaminase activity Molecular Function

GO:0016829 lyase activity Molecular Function

KEGG gene cross-reference

ani:ANIA_07430

ath:AT4G26900

sce:YBR248C

tye:THEYE_A1958

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.431

Rank 1 · TkA04G272610 · TK1151

Cytoplasm0.430

Rank 2 · TkA04G272610 · TK1151

Mitochondrion0.102

Rank 3 · TkA04G272610 · TK1151

Cell membrane0.076

Rank 4 · TkA04G272610 · TK1151

Endoplasmic reticulum0.052

Rank 5 · TkA04G272610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01920Prefoldin_26-47 aa

PF04513Baculo_PEP_C6-60 aa

PF05531NPV_P108-45 aa

PF01519DUF168-54 aa

PF13094CENP-Q9-84 aa

PF10145PhageMin_Tail9-54 aa

PF29524YLL032C_N24-71 aa

PF19259Ty3_capsid69-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G272610	`PF01920`	Prefoldin_2	6	47	0.043	14.5
TkA04G272610	`PF04513`	Baculo_PEP_C	6	60	0.11	13.2
TkA04G272610	`PF05531`	NPV_P10	8	45	0.1	13.8
TkA04G272610	`PF01519`	DUF16	8	54	1.2	10.3
TkA04G272610	`PF13094`	CENP-Q	9	84	0.033	15.1
TkA04G272610	`PF10145`	PhageMin_Tail	9	54	0.2	12.3
TkA04G272610	`PF29524`	YLL032C_N	24	71	0.033	14.7
TkA04G272610	`PF19259`	Ty3_capsid	69	137	0.0027	17.9
TkA04G272610	`PF30901`	PEG10-RTL1_C-capsid	74	133	0.0067	17.1
TkA04G272610	`PF02023`	SCAN	105	138	0.2	12.2
TkA04G272610	`PF01519`	DUF16	205	244	1.2	10.3
TkA04G272610	`PF00977`	His_biosynth	366	423	0.0037	17.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ30`	Arabidopsis thaliana	sp\|Q9SZ30\|HIS4_ARATH Imidazole glycerol phosphate synthase hisHF, chloroplastic	54.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card