TkA04G272600 | RubberDandelionOmics

Gene overview

TkA04G272600

Reference: TK1151 Chr: Chr04 Coordinates: 68885613-68885966 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

354 bp · TkA04G272600|TK1151|cDNA

AGTGGGGAAATAGCTAATCTCATAGCCATTGATGCAGAAAGAATTGGTGACTTTGGCTGGTACATACATGATCCATGGCTAGTAATCATACAAGTTGGTTTGGCATTAGCGATTTTATATCTGAATCTCGGGTTTGCCTCATTTTATGCATTGGTAGCCATCAGTGTCGTGATGTTGGCTAATATTCCTCTGGGGAGTCTACAGGAGAAATTTCAAGAGGCGTTAATGAAATCCAAAGATAAGAGGATGAAACTCACAGC...

CDS

Download CDS FASTA

354 bp · TkA04G272600|TK1151|CDS

AGTGGGGAAATAGCTAATCTCATAGCCATTGATGCAGAAAGAATTGGTGACTTTGGCTGGTACATACATGATCCATGGCTAGTAATCATACAAGTTGGTTTGGCATTAGCGATTTTATATCTGAATCTCGGGTTTGCCTCATTTTATGCATTGGTAGCCATCAGTGTCGTGATGTTGGCTAATATTCCTCTGGGGAGTCTACAGGAGAAATTTCAAGAGGCGTTAATGAAATCCAAAGATAAGAGGATGAAACTCACAGC...

Protein

Download Protein FASTA

117 aa · TkA04G272600|TK1151|PROTEIN

SGEIANLIAIDAERIGDFGWYIHDPWLVIIQVGLALAILYLNLGFASFYALVAISVVMLANIPLGSLQEKFQEALMKSKDKRMKLTAEILRNMRILKLQGWEMKFLSKVVELRSLET

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G272600`
TK1151 ID	TkA04G272600
OH-1004 ID	LXL04_016171
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.400
Protein coverage (%)	TK1151 96.581 / OH-1004 7.666 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G272600

Location Chr04:68885613-68885966 (-)

Description Similar to ABCC3: ABC transporter C family member 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13080`	Pump for glutathione S-conjugates.	An ABC-transporter of Arabidopsis thaliana has both glutathione-conjugate and chlorophyll catabolite transport activity.1998 · DOI: 10.1046/j.1365-313x.1998.00076.x
`At3g13090`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At3g13100`	Pump for glutathione S-conjugates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XCD4`	ABC transporter that may affect phytic acid transport and compartmentalization.	No verified direct reference in this release
`Os03g0142800`	ABC transporter that may affect phytic acid transport and compartmentalization.	Mutations of the multi-drug resistance-associated protein ABC transporter gene 5 result in reduction of phytic acid in rice seeds.2009 · DOI: 10.1007/s00122-009-1018-1

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016171 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0051707 response to other organism Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT1G04120

ath:AT3G13080

ath:AT3G13090

ath:AT3G13100

dosa:Os03g0142800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.530

Rank 1 · TkA04G272600 · TK1151

Lysosome / Vacuole0.151

Rank 2 · TkA04G272600 · TK1151

Cell membrane0.126

Rank 3 · TkA04G272600 · TK1151

Cytoplasm0.110

Rank 4 · TkA04G272600 · TK1151

Golgi apparatus0.096

Rank 5 · TkA04G272600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664ABC_membrane1-111 aa

PF01601CoV_S26-39 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G272600	`PF00664`	ABC_membrane	1	111	6.2e-12	46.5
TkA04G272600	`PF01601`	CoV_S2	6	39	0.21	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK64`	Arabidopsis thaliana	sp\|Q9LK64\|AB3C_ARATH ABC transporter C family member 3	69.000%	Swiss-Prot	High
`Q8VZZ4`	Arabidopsis thaliana	sp\|Q8VZZ4\|AB6C_ARATH ABC transporter C family member 6	62.900%	Swiss-Prot	High
`Q9LK62`	Arabidopsis thaliana	sp\|Q9LK62\|AB7C_ARATH ABC transporter C family member 7	62.100%	Swiss-Prot	High
`A2XCD4`	Oryza sativa subsp. indica	sp\|A2XCD4\|AB13C_ORYSI ABC transporter C family member 13	50.900%	Swiss-Prot	High
`Q10RX7`	Oryza sativa subsp. japonica	sp\|Q10RX7\|AB13C_ORYSJ ABC transporter C family member 13	50.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card