TkA04G267520 | RubberDandelionOmics

Gene overview

TkA04G267520

Reference: TK1151 Chr: Chr04 Coordinates: 67609954-67613053 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1334 bp · TkA04G267520|TK1151|cDNA

TCCCTCTCCCTTCCCCTCCATATACGTTTCCAATCGTAAACATTCACAAAAAAGAACCCACCAAGAGGTGGGTCGATCAACGCAGAGAGGGATTTTGAGTAATCAAACATCATTTCATCATAAATTTTTGGTTTTTTAGGTTTAGAATTTCGAACCAGATTGGCTCCACAACAATGGCGATCATAACGCAGGATGTGATAACGGAATTCGAGAAGTTGATGGAATCAATTGACGAGCCACTCAAGAATACATTTGAGAAT...

CDS

Download CDS FASTA

1008 bp · TkA04G267520|TK1151|CDS

ATGGCGATCATAACGCAGGATGTGATAACGGAATTCGAGAAGTTGATGGAATCAATTGACGAGCCACTCAAGAATACATTTGAGAATTTGCATCAAGGGTATCCAACGGAGGTTCTGGTTCGGTTTCTTAAAGCAAGAGACGGGAATGTCCCCAAGGCCCACAAAATGCTTGTTGATTGTTTAAGTTGGAGGATTCAAAATGAGATTGATAATATATTATCGAAACCGATTGTTCCTGCTGACTTTTATAGAGGAGTTCG...

Protein

Download Protein FASTA

335 aa · TkA04G267520|TK1151|PROTEIN

MAIITQDVITEFEKLMESIDEPLKNTFENLHQGYPTEVLVRFLKARDGNVPKAHKMLVDCLSWRIQNEIDNILSKPIVPADFYRGVRDSQLVGMSGYTKEGRPVFAVGVGLSTYDKASIHYYVQSHIQINEYRDRILLPAAKKKFEHVSTCVKVLDMTGLKISQLGQLKLLTVISSIDDLNYPEKSDAYYIVNAPYIFSACWKVVRPLLQERTRKKVQVLSGCGKDELLKIMDYESLPHFVRGQSGESSKGSDSCFTMDH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G267520`
TK1151 ID	TkA04G267520
OH-1004 ID	LXL04_037280
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 35.944 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G267520`
Location	Chr04:67609954-67613053 (+)
Description	Similar to D6PKL2: Serine/threonine-protein kinase D6PKL2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037280` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006468 protein phosphorylation Biological Process GO:0009630 gravitropism Biological Process GO:0009638 phototropism Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0010540 basipetal auxin transport Biological Process GO:0048766 root hair initiation Biological Process GO:2000114 regulation of establishment of cell polarity Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009925 basal plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT4G26610 ath:AT5G47750 ath:AT5G55910 dosa:Os06g0291600 osa:4340792 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.679

Rank 1 · TkA04G267520 · TK1151

Nucleus0.179

Rank 2 · TkA04G267520 · TK1151

Cell membrane0.164

Rank 3 · TkA04G267520 · TK1151

Golgi apparatus0.107

Rank 4 · TkA04G267520 · TK1151

Endoplasmic reticulum0.078

Rank 5 · TkA04G267520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03765CRAL_TRIO_N10-59 aa

PF28528UBA_Pinta28-67 aa

PF00650CRAL_TRIO89-241 aa

PF13716CRAL_TRIO_2148-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G267520	`PF03765`	CRAL_TRIO_N	10	59	5.3e-11	43.2
TkA04G267520	`PF28528`	UBA_Pinta	28	67	0.086	13.8
TkA04G267520	`PF00650`	CRAL_TRIO	89	241	3.1e-21	76.5
TkA04G267520	`PF13716`	CRAL_TRIO_2	148	221	0.0021	19.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card