TkA04G264590 | RubberDandelionOmics

Gene overview

TkA04G264590

Reference: TK1151 Chr: Chr04 Coordinates: 66933137-66937320 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1527 bp · TkA04G264590|TK1151|cDNA

CTTAAAAACCCTTGGTGATCCCCGGGTTTTGTTACGGTCAACAAGAACAACCTTCCTTCAACAAGAAACCTACAGTAAATTAGCAAATCCTCGTTAAGAAGTTTCAATCAAATCGCTGAAGATATGAAGATCACTGTAATGACGGCTGATGAACAAATTATTACTTTAGAAGTAGATCGCGACGAATCCGTCGAGAATTTGAAAGCCCTGCTTGAAATTGAGTCTCAAGTATCACTCCAGCAACAGCAGCTGCTGTACAA...

CDS

Download CDS FASTA

1200 bp · TkA04G264590|TK1151|CDS

ATGAAGATCACTGTAATGACGGCTGATGAACAAATTATTACTTTAGAAGTAGATCGCGACGAATCCGTCGAGAATTTGAAAGCCCTGCTTGAAATTGAGTCTCAAGTATCACTCCAGCAACAGCAGCTGCTGTACAATGGAAAAGAGATGGGGAATGCTGAGACACTGAGTCGTTTGGGTGTTACAGATGGCGATTTAGTGATGATGGTTTCAACTCCTTCTTCGTCTTCTTCAAGGGGTTCTAGCAATGAAGTTAGCTT...

Protein

Download Protein FASTA

399 aa · TkA04G264590|TK1151|PROTEIN

MKITVMTADEQIITLEVDRDESVENLKALLEIESQVSLQQQQLLYNGKEMGNAETLSRLGVTDGDLVMMVSTPSSSSSRGSSNEVSLNPDGSAVDAAAFQQQVRNNSNLMTQLFQSDPELAQAVLGNDLNKLQDLLRMRHRQRSEMRRQQEEEMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGVPLKAFVDSGAQSTIISKSCAERLGLLRLLDNRYKGIAHGVGQSEILGRIHV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G264590`
TK1151 ID	TkA04G264590
OH-1004 ID	LXL04_037255
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 91.096 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G264590

Location Chr04:66933137-66937320 (+)

Description Similar to DDI1: Protein DNA-DAMAGE INDUCIBLE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13235`	Receptor of ubiquitinated protein targeted to ubiquitin/proteasome-mediated proteolysis (UPP).	The defective proteasome but not substrate recognition function is responsible for the null phenotypes of the Arabidopsis proteasome subunit RPN10.2011 · DOI: 10.1105/tpc.111.086702

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037255 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0015031 protein transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0031593 polyubiquitin modification-dependent protein binding Molecular Function

KEGG gene cross-reference

act:ACLA_007750

afm:AFUA_7G06050

ath:AT3G13235

nfi:NFIA_027290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.676

Rank 1 · TkA04G264590 · TK1151

Cytoplasm0.636

Rank 2 · TkA04G264590 · TK1151

Endoplasmic reticulum0.051

Rank 3 · TkA04G264590 · TK1151

Cell membrane0.044

Rank 4 · TkA04G264590 · TK1151

Golgi apparatus0.038

Rank 5 · TkA04G264590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11976Rad60-SLD1-68 aa

PF18036Ubiquitin_41-41 aa

PF00240ubiquitin3-71 aa

PF29299UBL_IKK6-46 aa

PF13650Asp_protease_254-100 aa

PF08284RVP_260-90 aa

PF15434FAM10473-123 aa

PF24669Ddi2_HDD95-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G264590	`PF11976`	Rad60-SLD	1	68	5.5e-09	36.4
TkA04G264590	`PF18036`	Ubiquitin_4	1	41	0.25	12.1
TkA04G264590	`PF00240`	ubiquitin	3	71	1.3e-15	57.6
TkA04G264590	`PF29299`	UBL_IKK	6	46	0.05	14.6
TkA04G264590	`PF13650`	Asp_protease_2	54	100	5.3e-12	47.0
TkA04G264590	`PF08284`	RVP_2	60	90	7.2e-06	26.6
TkA04G264590	`PF15434`	FAM104	73	123	0.086	14.1
TkA04G264590	`PF24669`	Ddi2_HDD	95	162	3.1e-08	34.3
TkA04G264590	`PF24669`	Ddi2_HDD	184	199	3.1e-08	34.3
TkA04G264590	`PF09668`	Asp_protease	191	299	4e-47	159.7
TkA04G264590	`PF13975`	gag-asp_proteas	202	293	5.9e-19	69.1
TkA04G264590	`PF13650`	Asp_protease_2	202	289	5.3e-12	47.0
TkA04G264590	`PF00077`	RVP	202	228	0.022	15.8
TkA04G264590	`PF08284`	RVP_2	204	302	7.2e-06	26.6
TkA04G264590	`PF30863`	PRO_PEG10-RTL1	212	305	6.9e-06	27.2
TkA04G264590	`PF15434`	FAM104	326	357	0.086	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1EBV4`	Arabidopsis thaliana	sp\|Q1EBV4\|DDI1_ARATH Protein DNA-DAMAGE INDUCIBLE 1	74.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card