Gene Card
Gene overview
cDNA / CDS / Protein Sequences
477 bp · TkA04G263960|TK1151|cDNA
AATAGTAAGAAGGAAGCTCAAGGCTGCATATATAATGCTTCTTACGACACCCAATTTGGATTCTGCTGCGACATAGACGAAGAAACTTCCCAAAAACTCGCAGGTTTGCCAGAAGTATTATCGATTAATCCTGATCCAGATTTCAACTCTATACAAAAAGATTATACCAATGAAAAGACTGAATCACATTCGTCTAATAAATTGAAGAACTGGCTTGTTCGTGTAGAGATGCCACCATTGTCAGTCATCACTAGGGCACA...
477 bp · TkA04G263960|TK1151|CDS
AATAGTAAGAAGGAAGCTCAAGGCTGCATATATAATGCTTCTTACGACACCCAATTTGGATTCTGCTGCGACATAGACGAAGAAACTTCCCAAAAACTCGCAGGTTTGCCAGAAGTATTATCGATTAATCCTGATCCAGATTTCAACTCTATACAAAAAGATTATACCAATGAAAAGACTGAATCACATTCGTCTAATAAATTGAAGAACTGGCTTGTTCGTGTAGAGATGCCACCATTGTCAGTCATCACTAGGGCACA...
Protein
Download Protein FASTA158 aa · TkA04G263960|TK1151|PROTEIN
NSKKEAQGCIYNASYDTQFGFCCDIDEETSQKLAGLPEVLSINPDPDFNSIQKDYTNEKTESHSSNKLKNWLVRVEMPPLSVITRAQLVDYYTQILTKVLGNEKDAQKCIYHISSQSNYGFCCEVNDEHANELSSVPGVISVRPDESFDSDDKNYGGI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G263960 |
|---|---|
| TK1151 ID | TkA04G263960 |
| OH-1004 ID | LXL04_037243 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 98.734 / OH-1004 86.667Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G263960 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:66748137-66748916 (+) | ||||||||||||||||||
| Description | Similar to ORRM1: Organelle RRM domain-containing protein 1, chloroplastic | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0006397 mRNA processing Biological Process GO:0009409 response to cold Biological Process GO:0016554 cytidine to uridine editing Biological Process GO:0080156 mitochondrial mRNA modification Biological Process GO:1900871 chloroplast mRNA modification Biological Process GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT3G20930 dosa:Os02g0730800 osa:4330618 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF21864MORF_dom1-59 aaPF05922Inhibitor_I913-45 aaPF23045DUF703718-29 aaPF21864MORF_dom69-157 aaPF05922Inhibitor_I992-147 aaPF23045DUF7037119-129 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G263960 | PF21864 | MORF_dom | 1 | 59 | 4.2e-57 | 190.7 |
| TkA04G263960 | PF05922 | Inhibitor_I9 | 13 | 45 | 2.2e-07 | 32.1 |
| TkA04G263960 | PF23045 | DUF7037 | 18 | 29 | 0.0005 | 20.7 |
| TkA04G263960 | PF21864 | MORF_dom | 69 | 157 | 4.2e-57 | 190.7 |
| TkA04G263960 | PF05922 | Inhibitor_I9 | 92 | 147 | 2.2e-07 | 32.1 |
| TkA04G263960 | PF23045 | DUF7037 | 119 | 129 | 0.0005 | 20.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q8L440 | Arabidopsis thaliana | sp|Q8L440|ORRM1_ARATH Organelle RRM domain-containing protein 1, chloroplastic | 48.400% | Swiss-Prot | Medium |
Q9C7Y2 | Arabidopsis thaliana | sp|Q9C7Y2|MORF5_ARATH Multiple organellar RNA editing factor 5, chloroplastic/mitochondrial | 55.600% | Swiss-Prot | Low |
O82169 | Arabidopsis thaliana | sp|O82169|MORF6_ARATH Multiple organellar RNA editing factor 6, mitochondrial | 53.700% | Swiss-Prot | Low |
Q6YWP9 | Oryza sativa subsp. japonica | sp|Q6YWP9|ORRM1_ORYSJ Organelle RRM domain-containing protein 1, chloroplastic | 48.500% | Swiss-Prot | Medium |