TkA04G258980 | RubberDandelionOmics

Gene overview

TkA04G258980

Reference: TK1151 Chr: Chr04 Coordinates: 65468317-65473051 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1468 bp · TkA04G258980|TK1151|cDNA

TTTGACTCAAAACCCAGCCCATATAATCTTAAATCGCCACGGTCAACAGTCAAGAATCCAATCCCTCTTTCTTCTATCTCCAGATTAACGTGGCACCACCATGAGCAAGCTAACCTCATCAAGCTCCGAGCTAGACCTAGATCGCCCCAACATCGAAGACTACCTTCCTCCTGATTCCATTCCGCAACCTCACGCCAAGCTTCGTCTGCGCGATTTGCTGGACATCTCCCCGACGTTAACGGAGGCCGCCGGTGCCATTG...

CDS

Download CDS FASTA

1116 bp · TkA04G258980|TK1151|CDS

ATGAGCAAGCTAACCTCATCAAGCTCCGAGCTAGACCTAGATCGCCCCAACATCGAAGACTACCTTCCTCCTGATTCCATTCCGCAACCTCACGCCAAGCTTCGTCTGCGCGATTTGCTGGACATCTCCCCGACGTTAACGGAGGCCGCCGGTGCCATTGTCGATGATTCATTCACTCGATGCTTCAAATCAAATCCTCCAGAGCCTTGGAACTGGAATATATATCTATTTCCTTTGTGGTGTTTGGGAGTTGTGGTTAG...

Protein

Download Protein FASTA

371 aa · TkA04G258980|TK1151|PROTEIN

MSKLTSSSSELDLDRPNIEDYLPPDSIPQPHAKLRLRDLLDISPTLTEAAGAIVDDSFTRCFKSNPPEPWNWNIYLFPLWCLGVVVRYGILFPGRVLVLTIGWIIFLSCYVPVHLLLTGHDKLRKRLERALVELICSFFVASWTGVVKYHGPRPCARPKQVFVANHTSMIDFIVLEQMTAFAVIMQKHPGWVGLLQSTILDSLGCIWFNRSEAKDREIVARKLREHVEGSDNNPLLIFPEGTCVNNQFTVMFKKGAFELG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G258980`
TK1151 ID	TkA04G258980
OH-1004 ID	LXL04_037221
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G258980

Location Chr04:65468317-65473051 (-)

Description Similar to GPAT9: Glycerol-3-phosphate acyltransferase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60620`	Essential protein.	Identification of Arabidopsis GPAT9 (At5g60620) as an Essential Gene Involved in Triacylglycerol Biosynthesis.2016 · DOI: 10.1104/pp.15.01563 Arabidopsis GPAT9 contributes to synthesis of intracellular glycerolipids but not surface lipids.2016 · DOI: 10.1093/jxb/erw242

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037221 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006072 glycerol-3-phosphate metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006651 diacylglycerol biosynthetic process Biological Process

GO:0006654 phosphatidic acid biosynthetic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0010152 pollen maturation Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0016024 CDP-diacylglycerol biosynthetic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0019915 lipid storage Biological Process

GO:0032006 regulation of TOR signaling Biological Process

GO:0048229 gametophyte development Biological Process

KEGG gene cross-reference

ath:AT5G60620

gga:422610

hsa:84803

mmu:231510

rno:305166

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.712

Rank 1 · TkA04G258980 · TK1151

Nucleus0.118

Rank 2 · TkA04G258980 · TK1151

Cytoplasm0.109

Rank 3 · TkA04G258980 · TK1151

Golgi apparatus0.102

Rank 4 · TkA04G258980 · TK1151

Cell membrane0.083

Rank 5 · TkA04G258980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01553Acyltransferase147-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G258980	`PF01553`	Acyltransferase	147	269	5.2e-24	85.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWG0`	Arabidopsis thaliana	sp\|Q8GWG0\|GPAT9_ARATH Glycerol-3-phosphate acyltransferase 9	83.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card