TkA04G255760 | RubberDandelionOmics

Gene overview

TkA04G255760

Reference: TK1151 Chr: Chr04 Coordinates: 64688020-64689373 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1253 bp · TkA04G255760|TK1151|cDNA

AAGCAAGCTCACATCTCCCATAAAACCCACCACCGAAAGCCTTTCTCACCTACGCTACATTTGCATGCTTTCTCTCCCCTTCTCATTCTCTCTCTAAATACACACACAATACTTCGCATTTTGCAACCTGAATCACAGAGATCAGAGAACACGAAGAAAAAACTTTGTATACAGCTTACATGGCGGTTGAGGCAACCCAGCACAGTCTTTACCATCCTCAAATGATGATAACAAACGCCATTGATAACCAAGCAAACGGT...

CDS

Download CDS FASTA

966 bp · TkA04G255760|TK1151|CDS

ATGGCGGTTGAGGCAACCCAGCACAGTCTTTACCATCCTCAAATGATGATAACAAACGCCATTGATAACCAAGCAAACGGTAATGGTCATTTAGGATACGGAATCGGTCTTCCTTTCTCTGCAACCACCGCAGCGATGTACTGCTCTGGTTTCAACGATTCGATTAACGCGTTTCCGGCCAATACTGGTAACCTGAAGTCGGATAGTGGCCTCACTTGCAGTCTTCCTGTTTCGAGAAAACGAGCTAGAGATTGTTCCGA...

Protein

Download Protein FASTA

321 aa · TkA04G255760|TK1151|PROTEIN

MAVEATQHSLYHPQMMITNAIDNQANGNGHLGYGIGLPFSATTAAMYCSGFNDSINAFPANTGNLKSDSGLTCSLPVSRKRARDCSDINNTLLSFVNSQNTNQNQIGSYTFLGEDISLQIQQQQLEIDQFVAHHTEKVRLDIEERRKRNSRRLIAAVEEGLSKRLRAKEEEIVKIAKLNWALEERVKSLCVENQIWRELAQTNEATANALRTNLKQVLEQVVHDDFRHRSKTACVDDAGDAQSCCESNNEERRTLLDHDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G255760`
TK1151 ID	TkA04G255760
OH-1004 ID	LXL04_037181
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 95.252 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G255760

Location Chr04:64688020-64689373 (-)

Description Similar to BRG3: Probable BOI-related E3 ubiquitin-protein ligase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12920`	Probable E3 ubiquitin-protein ligase.	DELLA proteins and their interacting RING Finger proteins repress gibberellin responses by binding to the promoters of a subset of gibberellin-responsive genes in Arabidopsis.2013 · DOI: 10.1105/tpc.112.108951
`At1g79110`	Probable E3 ubiquitin-protein ligase.	DELLA proteins and their interacting RING Finger proteins repress gibberellin responses by binding to the promoters of a subset of gibberellin-responsive genes in Arabidopsis.2013 · DOI: 10.1105/tpc.112.108951
`At5g45100`	E3 ubiquitin-protein ligase involved in regulation of abiotic stress responses.	DELLA proteins and their interacting RING Finger proteins repress gibberellin responses by binding to the promoters of a subset of gibberellin-responsive genes in Arabidopsis.2013 · DOI: 10.1105/tpc.112.108951
`At4g19700`	E3 ubiquitin-protein ligase involved in the regulation of pathogen and abiotic stress responses by facilitating degradation of MYB108/BOI.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037181 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G79110

ath:AT3G12920

ath:AT4G19700

ath:AT4G39050

ath:AT5G45100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.892

Rank 1 · TkA04G255760 · TK1151

Cytoplasm0.172

Rank 2 · TkA04G255760 · TK1151

Cell membrane0.041

Rank 3 · TkA04G255760 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA04G255760 · TK1151

Plastid0.014

Rank 5 · TkA04G255760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02169LPP20201-256 aa

PF13920zf-C3HC4_3271-311 aa

PF14447Prok-RING_4274-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G255760	`PF02169`	LPP20	201	256	0.25	12.6
TkA04G255760	`PF13920`	zf-C3HC4_3	271	311	3e-10	40.4
TkA04G255760	`PF14447`	Prok-RING_4	274	310	0.037	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDD1`	Arabidopsis thaliana	sp\|Q9LDD1\|BRG3_ARATH Probable BOI-related E3 ubiquitin-protein ligase 3	45.400%	Swiss-Prot	Medium
`F4IDI6`	Arabidopsis thaliana	sp\|F4IDI6\|BRG2_ARATH Probable BOI-related E3 ubiquitin-protein ligase 2	44.300%	Swiss-Prot	Medium
`Q9FHE4`	Arabidopsis thaliana	sp\|Q9FHE4\|BRG1_ARATH BOI-related E3 ubiquitin-protein ligase 1	40.800%	Swiss-Prot	Medium
`O81851`	Arabidopsis thaliana	sp\|O81851\|BOI_ARATH E3 ubiquitin-protein ligase BOI	43.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card