Gene Card
Gene overview
cDNA / CDS / Protein Sequences
303 bp · TkA04G252870|TK1151|cDNA
ATGTTGCACTTACACTTGGTGGTTCAAATGGGCATTTCAATAAGACTTCTTGCTGATGCATCTGCCTCATTTGAAAAGAACTGTGTAAGAGGCATTCAAGCCAACAGGGACAGAATCTCAAAGCTATTGCATGAGTCACTTATGCTTGTGACATCTCTGAATCCAGTAAGACTCTCAATGAAGTTCCATCATTTGCATTCAATCAATCTGTCCAAAATCCATCAGAAACCCAATCTTTTTTCGACTTGCGAACACCCACC...
303 bp · TkA04G252870|TK1151|CDS
ATGTTGCACTTACACTTGGTGGTTCAAATGGGCATTTCAATAAGACTTCTTGCTGATGCATCTGCCTCATTTGAAAAGAACTGTGTAAGAGGCATTCAAGCCAACAGGGACAGAATCTCAAAGCTATTGCATGAGTCACTTATGCTTGTGACATCTCTGAATCCAGTAAGACTCTCAATGAAGTTCCATCATTTGCATTCAATCAATCTGTCCAAAATCCATCAGAAACCCAATCTTTTTTCGACTTGCGAACACCCACC...
Protein
Download Protein FASTA100 aa · TkA04G252870|TK1151|PROTEIN
MLHLHLVVQMGISIRLLADASASFEKNCVRGIQANRDRISKLLHESLMLVTSLNPVRLSMKFHHLHSINLSKIHQKPNLFSTCEHPPISLFFPVSTKETP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G252870 |
|---|---|
| TK1151 ID | TkA04G252870 |
| OH-1004 ID | LXL04_002598 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 96.600 |
| Protein coverage (%) | TK1151 88.000 / OH-1004 42.105Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G252870 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:63962900-63963420 (-) | |||||||||
| Description | Similar to FUM2: Fumarate hydratase 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000050 urea cycle Biological Process GO:0006099 tricarboxylic acid cycle Biological Process GO:0006106 fumarate metabolic process Biological Process GO:0006108 malate metabolic process Biological Process GO:0006281 DNA repair Biological Process GO:0006525 arginine metabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0009631 cold acclimation Biological Process GO:0010109 regulation of photosynthesis Biological Process GO:0042128 nitrate assimilation Biological Process GO:0048868 pollen tube development Biological Process GO:0051262 protein tetramerization Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G47510 ath:AT5G50950 hsa:2271 mmu:14194 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08678Rsbr_N7-40 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G252870 | PF08678 | Rsbr_N | 7 | 40 | 0.11 | 13.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.