TkA04G249620 | RubberDandelionOmics

Gene overview

TkA04G249620

Reference: TK1151 Chr: Chr04 Coordinates: 63149230-63149742 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · TkA04G249620|TK1151|cDNA

ATGAAGAATGGGAAGAAGGTGGACAATGTCCCTGTTCGTGTTAACATCAACGACAAAAAGTACGTCATAGGGACTCTTTCTTCAGAACGTGCACCCCAAATCATTTTCGATCTGGTTTTCGAGCAAGATCTTGAGCTCTCCCATGGATGGAAAGATGGCAGCGTCTACTTCTATTCTTCTGATGAAGAAGAAGCAATGAACCTTGCTGCCAATGGTCCAATTCAAGGTAAGCCAAAGGCATCTATCAAGGATGTAACTGA...

CDS

Download CDS FASTA

465 bp · TkA04G249620|TK1151|CDS

ATGAAGAATGGGAAGAAGGTGGACAATGTCCCTGTTCGTGTTAACATCAACGACAAAAAGTACGTCATAGGGACTCTTTCTTCAGAACGTGCACCCCAAATCATTTTCGATCTGGTTTTCGAGCAAGATCTTGAGCTCTCCCATGGATGGAAAGATGGCAGCGTCTACTTCTATTCTTCTGATGAAGAAGAAGCAATGAACCTTGCTGCCAATGGTCCAATTCAAGGTAAGCCAAAGGCATCTATCAAGGATGTAACTGA...

Protein

Download Protein FASTA

154 aa · TkA04G249620|TK1151|PROTEIN

MKNGKKVDNVPVRVNINDKKYVIGTLSSERAPQIIFDLVFEQDLELSHGWKDGSVYFYSSDEEEAMNLAANGPIQGKPKASIKDVTEEDDSEDDEDDSDDEMADSDDEDDSGEEEEDDESDSKQLSKSNSKLDVLNSSPIREAFSPNDCLKSNY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G249620`
TK1151 ID	TkA04G249620
OH-1004 ID	LXL04_028302
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 60.390 / OH-1004 49.733 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G249620`
Location	Chr04:63149230-63149742 (-)
Description	Similar to HDT1: Histone deacetylase HDT1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028302` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006325 chromatin organization Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0009294 DNA-mediated transformation Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009944 polarity specification of adaxial/abaxial axis Biological Process GO:0010162 seed dormancy process Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0048364 root development Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT3G44750 ath:AT5G03740 gmx:547649 zma:542636 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.857

Rank 1 · TkA04G249620 · TK1151

Cytoplasm0.254

Rank 2 · TkA04G249620 · TK1151

Cell membrane0.029

Rank 3 · TkA04G249620 · TK1151

Extracellular0.027

Rank 4 · TkA04G249620 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA04G249620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17800NPL6-56 aa

PF30130VID28_C59-123 aa

PF06524NOA3660-121 aa

PF04147Nop1461-129 aa

PF09184PPP4R271-120 aa

PF05327RRN375-135 aa

PF04889Cwf_Cwc_1576-128 aa

PF05477SURF280-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G249620	`PF17800`	NPL	6	56	0.00025	22.4
TkA04G249620	`PF30130`	VID28_C	59	123	1.2	8.6
TkA04G249620	`PF06524`	NOA36	60	121	0.017	15.2
TkA04G249620	`PF04147`	Nop14	61	129	0.55	9.1
TkA04G249620	`PF09184`	PPP4R2	71	120	0.57	10.4
TkA04G249620	`PF05327`	RRN3	75	135	0.055	12.7
TkA04G249620	`PF04889`	Cwf_Cwc_15	76	128	2.2	8.8
TkA04G249620	`PF05477`	SURF2	80	129	4.4	7.5
TkA04G249620	`PF23798`	Beta-prop_SPT8	82	128	1.2	8.7
TkA04G249620	`PF02724`	CDC45	83	128	0.31	10.0
TkA04G249620	`PF10498`	IFT57	83	134	5.8	6.5
TkA04G249620	`PF12226`	Astro_capsid_p	83	123	8.3	6.2
TkA04G249620	`PF04931`	DNA_pol_phi	84	123	0.14	11.0
TkA04G249620	`PF13299`	CPSF100_C	84	140	0.14	13.0
TkA04G249620	`PF04546`	Sigma70_ner	84	126	1.1	9.9
TkA04G249620	`PF09073`	BUD22	84	129	2.1	8.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card