TkA04G248040 | RubberDandelionOmics

Gene overview

TkA04G248040

Reference: TK1151 Chr: Chr04 Coordinates: 62758920-62760544 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

501 bp · TkA04G248040|TK1151|cDNA

ATGCGTGGGCACCTCACAGAAAAGACGGATGTGTTTGGGTTTGGAGTTGTGACTCTCGAGATTATCAGTGGAAGGTTCAATTCTGATTCGAGTTTCGAAGATGAGAAAATATATCTTCTTGAATGGGCATGGAACCTACATGAAGGGCACCGCGAAATCAAATTGGTGGATGAAGAATTGTCTGAATTTGATGAAAACGAAGTGAAAAGAATAATGAGAGTTGCCCTTTTATGCACGCAAACATCGCCAACACAACGACC...

CDS

Download CDS FASTA

501 bp · TkA04G248040|TK1151|CDS

ATGCGTGGGCACCTCACAGAAAAGACGGATGTGTTTGGGTTTGGAGTTGTGACTCTCGAGATTATCAGTGGAAGGTTCAATTCTGATTCGAGTTTCGAAGATGAGAAAATATATCTTCTTGAATGGGCATGGAACCTACATGAAGGGCACCGCGAAATCAAATTGGTGGATGAAGAATTGTCTGAATTTGATGAAAACGAAGTGAAAAGAATAATGAGAGTTGCCCTTTTATGCACGCAAACATCGCCAACACAACGACC...

Protein

Download Protein FASTA

166 aa · TkA04G248040|TK1151|PROTEIN

MRGHLTEKTDVFGFGVVTLEIISGRFNSDSSFEDEKIYLLEWAWNLHEGHREIKLVDEELSEFDENEVKRIMRVALLCTQTSPTQRPPMSRVVAMISGDIEASGVINRPEYLTGFRFDDATTFKSVVPALGSDVVASTSQLTLSPLSPCSPHETQPMLSDIIGEGR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G248040`
TK1151 ID	TkA04G248040
OH-1004 ID	LXL04_037156
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.200
Protein coverage (%)	TK1151 100.000 / OH-1004 25.978 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G248040

Location Chr04:62758920-62760544 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56140`	Probable LRR receptor-like serine/threonine-protein kinase At1g56140.	No verified direct reference in this release
`At1g56130`	Probable LRR receptor-like serine/threonine-protein kinase At1g56130.	No verified direct reference in this release
`At1g53440`	Probable LRR receptor-like serine/threonine-protein kinase At1g53440.	No verified direct reference in this release
`At1g53430`	Probable LRR receptor-like serine/threonine-protein kinase At1g53430.	No verified direct reference in this release
`At1g16670`	Negative regulator of freezing tolerance that phosphorylates 14-3-3 proteins (e.g. GRF6) thus triggering their translocation from the cytosol to the nucleus in response to cold stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037156 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031667 response to nutrient levels Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0052542 defense response by callose deposition Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0033612 receptor serine/threonine kinase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G07650

ath:AT1G53430

ath:AT1G53440

ath:AT1G56130

ath:AT1G56140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.552

Rank 1 · TkA04G248040 · TK1151

Cytoplasm0.342

Rank 2 · TkA04G248040 · TK1151

Nucleus0.240

Rank 3 · TkA04G248040 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA04G248040 · TK1151

Golgi apparatus0.047

Rank 5 · TkA04G248040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr3-94 aa

PF00866Ring_hydroxyl_B32-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G248040	`PF07714`	PK_Tyr_Ser-Thr	3	94	6e-05	23.2
TkA04G248040	`PF00866`	Ring_hydroxyl_B	32	97	0.18	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGH3`	Arabidopsis thaliana	sp\|C0LGH3\|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140	54.800%	Swiss-Prot	High
`C0LGH2`	Arabidopsis thaliana	sp\|C0LGH2\|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130	54.200%	Swiss-Prot	High
`C0LGG9`	Arabidopsis thaliana	sp\|C0LGG9\|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440	51.000%	Swiss-Prot	Medium
`C0LGG8`	Arabidopsis thaliana	sp\|C0LGG8\|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430	50.000%	Swiss-Prot	Medium
`Q93YN1`	Arabidopsis thaliana	sp\|Q93YN1\|CRPK1_ARATH Cold-responsive protein kinase 1	42.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card