TkA04G237160 | RubberDandelionOmics

Gene overview

TkA04G237160

Reference: TK1151 Chr: Chr04 Coordinates: 60211615-60213396 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

749 bp · TkA04G237160|TK1151|cDNA

ATGTTAGGGTTCTTCTGCTCGCAAAATCGAAACCCTAGCTGTCTTCTCTACAAAACATCTTCAAGTCCACCTGAAATAGAGGGTGCGACAGCCCTCTCTGCCATCTCAATCATTTATAAACCACTGGAGGGTGACGGAGGAGAAGGGACGGCTTCGTGGACTAAGCGCTTATCTAGGCGGGAGCAAGAGTCAGGATTATACTTCAACGTTAAGTATTTTGAGGAGAAAGTCCATGCTGGTGAATGGGATGAATTAGAGAA...

CDS

Download CDS FASTA

570 bp · TkA04G237160|TK1151|CDS

ATGTTAGGGTTCTTCTGCTCGCAAAATCGAAACCCTAGCTGTCTTCTCTACAAAACATCTTCAAGTCCACCTGAAATAGAGGGTGCGACAGCCCTCTCTGCCATCTCAATCATTTATAAACCACTGGAGGGTGACGGAGGAGAAGGGACGGCTTCGTGGACTAAGCGCTTATCTAGGCGGGAGCAAGAGTCAGGATTATACTTCAACGTTAAGTATTTTGAGGAGAAAGTCCATGCTGGTGAATGGGATGAATTAGAGAA...

Protein

Download Protein FASTA

189 aa · TkA04G237160|TK1151|PROTEIN

MLGFFCSQNRNPSCLLYKTSSSPPEIEGATALSAISIIYKPLEGDGGEGTASWTKRLSRREQESGLYFNVKYFEEKVHAGEWDELEKYLSGYTKRDNEQLSNYGDTKIEVNSLYFGQLWVWIHAAALTEGYNALKSACESQGKEVVKNGHKNSSASAISGDGRKEKLDAEKVRILMLISMKFVKIGLLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G237160`
TK1151 ID	TkA04G237160
OH-1004 ID	LXL04_039319
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G237160

Location Chr04:60211615-60213396 (-)

Description Similar to TPR1: Protein TPR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16830`	Transcriptional corepressor.	No verified direct reference in this release
`At1g80490`	Transcriptional corepressor.	Arabidopsis resistance protein SNC1 activates immune responses through association with a transcriptional corepressor.2010 · DOI: 10.1073/pnas.1002828107
`At1g15750`	Transcriptional corepressor.	No verified direct reference in this release
`At5g27030`	Transcriptional corepressor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0254100`	Probable downstream regulator of strigolactones signaling.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039319 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010072 primary shoot apical meristem specification Biological Process

GO:0010336 gibberellic acid homeostasis Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0062208 positive regulation of pattern recognition receptor signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G15750

ath:AT1G80490

ath:AT3G15880

ath:AT3G16830

dosa:Os01g0254100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.436

Rank 1 · TkA04G237160 · TK1151

Cytoplasm0.395

Rank 2 · TkA04G237160 · TK1151

Cell membrane0.120

Rank 3 · TkA04G237160 · TK1151

Endoplasmic reticulum0.103

Rank 4 · TkA04G237160 · TK1151

Mitochondrion0.088

Rank 5 · TkA04G237160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30557DUF862652-71 aa

PF21889TPR1-like_2nd69-101 aa

PF23295Arm_469-144 aa

PF24087DUF737271-84 aa

PF21889TPR1-like_2nd95-113 aa

PF24087DUF7372102-123 aa

PF13074DUF3938107-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G237160	`PF30557`	DUF8626	52	71	0.23	11.6
TkA04G237160	`PF21889`	TPR1-like_2nd	69	101	1.1e-09	39.3
TkA04G237160	`PF23295`	Arm_4	69	144	0.0083	16.2
TkA04G237160	`PF24087`	DUF7372	71	84	0.26	11.9
TkA04G237160	`PF21889`	TPR1-like_2nd	95	113	1.1e-09	39.3
TkA04G237160	`PF24087`	DUF7372	102	123	0.26	11.9
TkA04G237160	`PF13074`	DUF3938	107	142	0.21	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRZ0`	Arabidopsis thaliana	sp\|Q9LRZ0\|TPR2_ARATH Topless-related protein 2	64.400%	Swiss-Prot	Low
`Q0WV90`	Arabidopsis thaliana	sp\|Q0WV90\|TPR1_ARATH Topless-related protein 1	60.000%	Swiss-Prot	Low
`Q94AI7`	Arabidopsis thaliana	sp\|Q94AI7\|TPL_ARATH Protein TOPLESS	60.000%	Swiss-Prot	Low
`Q84JM4`	Arabidopsis thaliana	sp\|Q84JM4\|TPR3_ARATH Topless-related protein 3	60.000%	Swiss-Prot	Low
`Q5NBT9`	Oryza sativa subsp. japonica	sp\|Q5NBT9\|TPR1_ORYSJ Protein TPR1	68.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card