TkA04G232010 | RubberDandelionOmics

Gene overview

TkA04G232010

Reference: TK1151 Chr: Chr04 Coordinates: 58903714-58904346 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkA04G232010|TK1151|cDNA

ATGATTAGTTTGAAGGATCTCTACAATGGACAATGCTTTGCACCGCTCATAATCAGATCCAAAAATCTTAGAACCTTAAGACTTTTCAGATGTTTCAGAGATTGGGATGACGTTCTTAAACTTGTTAGCAATAACATCAAGGGATTGAACGAGGCCCTTTCAAATTGTCAAAATCTTGAAATCCTTCACCTTCTGAAAACTCCCGATTGTACTAATTCGGGGCTAACGTCCATGGCGGAGAACTGTAAGCTTCTAAGGAA...

CDS

Download CDS FASTA

591 bp · TkA04G232010|TK1151|CDS

ATGATTAGTTTGAAGGATCTCTACAATGGACAATGCTTTGCACCGCTCATAATCAGATCCAAAAATCTTAGAACCTTAAGACTTTTCAGATGTTTCAGAGATTGGGATGACGTTCTTAAACTTGTTAGCAATAACATCAAGGGATTGAACGAGGCCCTTTCAAATTGTCAAAATCTTGAAATCCTTCACCTTCTGAAAACTCCCGATTGTACTAATTCGGGGCTAACGTCCATGGCGGAGAACTGTAAGCTTCTAAGGAA...

Protein

Download Protein FASTA

196 aa · TkA04G232010|TK1151|PROTEIN

MISLKDLYNGQCFAPLIIRSKNLRTLRLFRCFRDWDDVLKLVSNNIKGLNEALSNCQNLEILHLLKTPDCTNSGLTSMAENCKLLRKLHIDGWKTNRIDDEGLIDVAKNCPNLQELVLIRVNPIRASLERFASNCQKLERLALCGSETFGDAEISCIAGKFMALRKLCIKSCPVSDHGMEALALGCPNLVIVKVKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G232010`
TK1151 ID	TkA04G232010
OH-1004 ID	LXL04_039335
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.000
Protein coverage (%)	TK1151 100.000 / OH-1004 91.703 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G232010

Location Chr04:58903714-58904346 (-)

Description Similar to FBL8: Putative F-box/LRR-repeat protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g07400`	Putative F-box/LRR-repeat protein 8.	No verified direct reference in this release
`At5g67250`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g47056`	F-box protein At1g47056.	No verified direct reference in this release
`At3g50080`	F-box/LRR-repeat protein 16.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039335 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006289 nucleotide-excision repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010225 response to UV-C Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G47056

ath:AT3G50080

ath:AT4G07400

ath:AT4G15475

ath:AT5G67250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.615

Rank 1 · TkA04G232010 · TK1151

Cytoplasm0.237

Rank 2 · TkA04G232010 · TK1151

Cell membrane0.077

Rank 3 · TkA04G232010 · TK1151

Plastid0.045

Rank 4 · TkA04G232010 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkA04G232010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29594LRR_SKP212-33 aa

PF23622LRR_At1g61320_AtMIF120-172 aa

PF13516LRR_620-31 aa

PF25372LRR_FBXL1521-192 aa

PF12799LRR_421-30 aa

PF13855LRR_822-28 aa

PF12799LRR_438-64 aa

PF13855LRR_838-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G232010	`PF29594`	LRR_SKP2	12	33	0.0016	18.5
TkA04G232010	`PF23622`	LRR_At1g61320_AtMIF1	20	172	0.011	15.8
TkA04G232010	`PF13516`	LRR_6	20	31	0.23	12.3
TkA04G232010	`PF25372`	LRR_FBXL15	21	192	4e-09	36.1
TkA04G232010	`PF12799`	LRR_4	21	30	3.3e-06	27.9
TkA04G232010	`PF13855`	LRR_8	22	28	0.33	11.5
TkA04G232010	`PF12799`	LRR_4	38	64	3.3e-06	27.9
TkA04G232010	`PF13855`	LRR_8	38	64	0.33	11.5
TkA04G232010	`PF24758`	LRR_At5g56370	39	67	4.7e-10	40.2
TkA04G232010	`PF13516`	LRR_6	39	47	0.23	12.3
TkA04G232010	`PF23598`	LRR_14	44	183	0.0083	15.6
TkA04G232010	`PF08562`	Crisp	50	82	0.21	12.9
TkA04G232010	`PF29594`	LRR_SKP2	51	90	0.0016	18.5
TkA04G232010	`PF13516`	LRR_6	55	64	0.23	12.3
TkA04G232010	`PF24758`	LRR_At5g56370	57	147	4.7e-10	40.2
TkA04G232010	`PF12799`	LRR_4	73	100	3.3e-06	27.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9X4`	Arabidopsis thaliana	sp\|Q9S9X4\|FBL8_ARATH Putative F-box/LRR-repeat protein 8	61.000%	Swiss-Prot	High
`Q9FE83`	Arabidopsis thaliana	sp\|Q9FE83\|SKIP2_ARATH F-box protein SKIP2	59.800%	Swiss-Prot	High
`Q9C626`	Arabidopsis thaliana	sp\|Q9C626\|FB37_ARATH F-box protein At1g47056	58.600%	Swiss-Prot	High
`Q9SN10`	Arabidopsis thaliana	sp\|Q9SN10\|FBL16_ARATH F-box/LRR-repeat protein 16	54.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card