TkA04G231200 | RubberDandelionOmics

Gene overview

TkA04G231200

Reference: TK1151 Chr: Chr04 Coordinates: 58720909-58723091 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1395 bp · TkA04G231200|TK1151|cDNA

ATGCCTCCGAAACGCCGTGGACGACCCTCCGGAAATGGCGGCGCCCCACCAGTCTTTGACCCTGAGGCCATGGAGGCCGCAATAGCTCAACGGGTGGCAGAAGCCCTAGCGGCTTACGAACTTGCAAACCCTAGAAATAACAATGGTGGAGGTGGTGGTGCCGAAGGTGCAGGAGGAAACGGCGGAAACCCGAAGCCGTGTTCCTATAAAAATTTTATGAATTGCAAGCCCCACAACTTCGCCGGAACCGGAGGTGTCCT...

CDS

Download CDS FASTA

1395 bp · TkA04G231200|TK1151|CDS

ATGCCTCCGAAACGCCGTGGACGACCCTCCGGAAATGGCGGCGCCCCACCAGTCTTTGACCCTGAGGCCATGGAGGCCGCAATAGCTCAACGGGTGGCAGAAGCCCTAGCGGCTTACGAACTTGCAAACCCTAGAAATAACAATGGTGGAGGTGGTGGTGCCGAAGGTGCAGGAGGAAACGGCGGAAACCCGAAGCCGTGTTCCTATAAAAATTTTATGAATTGCAAGCCCCACAACTTCGCCGGAACCGGAGGTGTCCT...

Protein

Download Protein FASTA

464 aa · TkA04G231200|TK1151|PROTEIN

MPPKRRGRPSGNGGAPPVFDPEAMEAAIAQRVAEALAAYELANPRNNNGGGGGAEGAGGNGGNPKPCSYKNFMNCKPHNFAGTGGVLELTRWFEKTESVFQICDCPANCQVKFAACTFHHAALSWWNTHVQTIGLVQANAMTWEALKTMMTEEYCPRTELQKLEQELWNLKMQGSDITHYTNRFNELATLCPGMVTPMARKIERYIGGLSPQIQNSVTAFNPLTYESVKSVAIRMTDQAVRNGTMAPKAEPSREQHKRKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G231200`
TK1151 ID	TkA04G231200
OH-1004 ID	LXL04_015014
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	82.800
Protein coverage (%)	TK1151 85.991 / OH-1004 20.382 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G231200`
Location	Chr04:58720909-58723091 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015014` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009631 cold acclimation Biological Process GO:0009651 response to salt stress Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0003690 double-stranded DNA binding Molecular Function GO:0003697 single-stranded DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	ath:AT4G36020 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.563

Rank 1 · TkA04G231200 · TK1151

Nucleus0.511

Rank 2 · TkA04G231200 · TK1151

Cell membrane0.065

Rank 3 · TkA04G231200 · TK1151

Mitochondrion0.056

Rank 4 · TkA04G231200 · TK1151

Endoplasmic reticulum0.052

Rank 5 · TkA04G231200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19259Ty3_capsid69-236 aa

PF03732PEG10_N-capsid76-154 aa

PF29740DDB_G0287209_N225-276 aa

PF27939DUF8363312-327 aa

PF00098zf-CCHC314-318 aa

PF27939DUF8363327-381 aa

PF00098zf-CCHC329-343 aa

PF14392zf-CCHC_4329-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G231200	`PF19259`	Ty3_capsid	69	236	1e-12	48.6
TkA04G231200	`PF03732`	PEG10_N-capsid	76	154	1.1e-09	39.3
TkA04G231200	`PF29740`	DDB_G0287209_N	225	276	3.9	5.8
TkA04G231200	`PF27939`	DUF8363	312	327	0.026	15.0
TkA04G231200	`PF00098`	zf-CCHC	314	318	6.3e-06	26.8
TkA04G231200	`PF27939`	DUF8363	327	381	0.026	15.0
TkA04G231200	`PF00098`	zf-CCHC	329	343	6.3e-06	26.8
TkA04G231200	`PF14392`	zf-CCHC_4	329	344	0.029	14.7
TkA04G231200	`PF00098`	zf-CCHC	360	377	6.3e-06	26.8
TkA04G231200	`PF14392`	zf-CCHC_4	360	377	0.029	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card