TkA04G229750 | RubberDandelionOmics

Gene overview

TkA04G229750

Reference: TK1151 Chr: Chr04 Coordinates: 58368132-58369478 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

606 bp · TkA04G229750|TK1151|cDNA

ATGCCTCAAAATCTAAATCCTCCTAACCCACCTCAAGATTTGACACTTATACAAATGATGGAGACAGATGTTACTCAATCCCCTCTTGGCATTGTCTATCCCGCCAACCGAAGAGGGATCGAATTTAAGTCAAGCTTTCTACACCAACTATCCAAATTCCATGGTCTTGACAATGAGGATCCACAAAGGCACTTGAAGTCCTTTCATATGGCTGTAGAAAATAACCGATATCCGTTTTATCCGCCCGACCCATATGAATT...

CDS

Download CDS FASTA

606 bp · TkA04G229750|TK1151|CDS

ATGCCTCAAAATCTAAATCCTCCTAACCCACCTCAAGATTTGACACTTATACAAATGATGGAGACAGATGTTACTCAATCCCCTCTTGGCATTGTCTATCCCGCCAACCGAAGAGGGATCGAATTTAAGTCAAGCTTTCTACACCAACTATCCAAATTCCATGGTCTTGACAATGAGGATCCACAAAGGCACTTGAAGTCCTTTCATATGGCTGTAGAAAATAACCGATATCCGTTTTATCCGCCCGACCCATATGAATT...

Protein

Download Protein FASTA

201 aa · TkA04G229750|TK1151|PROTEIN

MPQNLNPPNPPQDLTLIQMMETDVTQSPLGIVYPANRRGIEFKSSFLHQLSKFHGLDNEDPQRHLKSFHMAVENNRYPFYPPDPYEFGLIGVARCVEIGLPQLIFLIILSQYLSYLIHSGKNIFDRFDVLISVAIVWIYAHLLTVGGAYNHTAPKTQSNCRTDRSGLIDAAPWIRVPYPFQWGAPSFDAGEAFTIMMAAQI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G229750`
TK1151 ID	TkA04G229750
OH-1004 ID	LXL04_039359
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G229750

Location Chr04:58368132-58369478 (+)

Description Similar to NAT6: Nucleobase-ascorbate transporter 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62890`	Nucleobase-ascorbate transporter 6.	No verified direct reference in this release
`At5g49990`	Nucleobase-ascorbate transporter 5.	No verified direct reference in this release
`At1g60030`	Nucleobase-ascorbate transporter 7.	No verified direct reference in this release
`At1g10540`	Nucleobase-ascorbate transporter 8.	No verified direct reference in this release
`At1g49960`	Nucleobase-ascorbate transporter 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039359 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G10540

ath:AT1G60030

ath:AT2G34190

ath:AT5G49990

ath:AT5G62890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.298

Rank 1 · TkA04G229750 · TK1151

Nucleus0.288

Rank 2 · TkA04G229750 · TK1151

Endoplasmic reticulum0.149

Rank 3 · TkA04G229750 · TK1151

Mitochondrion0.143

Rank 4 · TkA04G229750 · TK1151

Cell membrane0.094

Rank 5 · TkA04G229750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23593HEAT_ATR100-126 aa

PF00860Xan_ur_permease107-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G229750	`PF23593`	HEAT_ATR	100	126	0.07	13.8
TkA04G229750	`PF00860`	Xan_ur_permease	107	198	5.1e-06	26.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q27GI3`	Arabidopsis thaliana	sp\|Q27GI3\|NAT6_ARATH Nucleobase-ascorbate transporter 6	72.200%	Swiss-Prot	Medium
`Q8RWE9`	Arabidopsis thaliana	sp\|Q8RWE9\|NAT5_ARATH Nucleobase-ascorbate transporter 5	66.100%	Swiss-Prot	Medium
`Q0WPE9`	Arabidopsis thaliana	sp\|Q0WPE9\|NAT7_ARATH Nucleobase-ascorbate transporter 7	62.500%	Swiss-Prot	Medium
`Q8VZQ5`	Arabidopsis thaliana	sp\|Q8VZQ5\|NAT8_ARATH Nucleobase-ascorbate transporter 8	54.200%	Swiss-Prot	Medium
`P93039`	Arabidopsis thaliana	sp\|P93039\|NAT4_ARATH Nucleobase-ascorbate transporter 4	54.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card