TkA04G208040 | RubberDandelionOmics

Gene overview

TkA04G208040

Reference: TK1151 Chr: Chr04 Coordinates: 53315017-53318588 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1815 bp · TkA04G208040|TK1151|cDNA

AAAATGACGTGGTATTATATAGTTAGCGCACATTATAGTGTATGCTCTCGAGTCTCGAGTCTCTTCCTATAAGATCTCTTATCTCCCTCTCTCTCTTCCGAAAGCCTTGAGGCATCTTCTCTCCCTAAAATGGACTGTGTGGGGCTACTCCTCCTCTCTCTTGTTCTCACCTCTCTTTCTCCGGCGATCAGTCTCAGCCTCAAGGACGCCAAGTTTCCGTCGACTCAGGCGAGGAAGCTGATTAGAGAACTCAATTTGTT...

CDS

Download CDS FASTA

1497 bp · TkA04G208040|TK1151|CDS

ATGGACTGTGTGGGGCTACTCCTCCTCTCTCTTGTTCTCACCTCTCTTTCTCCGGCGATCAGTCTCAGCCTCAAGGACGCCAAGTTTCCGTCGACTCAGGCGAGGAAGCTGATTAGAGAACTCAATTTGTTCCCAAAACACTCGGTCAACATCATCGATCGCGATGTCATCAACCGTTCCTCTATTCTCGGTTCGAAGATAGTCGAGAAGCCTTTCAAATTCCCCAATTTCGCTGATGCAGACAGCGTCACCCTTGAAGA...

Protein

Download Protein FASTA

498 aa · TkA04G208040|TK1151|PROTEIN

MDCVGLLLLSLVLTSLSPAISLSLKDAKFPSTQARKLIRELNLFPKHSVNIIDRDVINRSSILGSKIVEKPFKFPNFADADSVTLEDLGHHAGYYQIEHSHDAQMFYFYFESRNSENDPVVIWLTGGPGCSSELALFYENGPFKIGDNLTLVWNEYGWDKASNLIYVDQPTGTGFSYSSDKRDIRHDEQGVSDDLYDFLQAFFTEHPELVKNDFYITGESYAGHYIPAVASRVHKGNKNKEGIHINLKGFAIGNGLTDPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G208040`
TK1151 ID	TkA04G208040
OH-1004 ID	LXL04_004551
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.600
Protein coverage (%)	TK1151 91.165 / OH-1004 89.648 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G208040

Location Chr04:53315017-53318588 (+)

Description Similar to CBP3: Serine carboxypeptidase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10410`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0479300`	Serine carboxypeptidase-like.	No verified direct reference in this release
`Os02g0114200`	Serine carboxypeptidase 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004551 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G10410

ath:AT3G45010

dosa:Os02g0114200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.625

Rank 1 · TkA04G208040 · TK1151

Cytoplasm0.113

Rank 2 · TkA04G208040 · TK1151

Extracellular0.113

Rank 3 · TkA04G208040 · TK1151

Endoplasmic reticulum0.108

Rank 4 · TkA04G208040 · TK1151

Golgi apparatus0.094

Rank 5 · TkA04G208040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450Peptidase_S1088-485 aa

PF18306LDcluster4120-141 aa

PF18306LDcluster4267-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G208040	`PF00450`	Peptidase_S10	88	485	8.1e-127	424.8
TkA04G208040	`PF18306`	LDcluster4	120	141	0.0075	16.7
TkA04G208040	`PF18306`	LDcluster4	267	309	0.0075	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P32826`	Arabidopsis thaliana	sp\|P32826\|SCP49_ARATH Serine carboxypeptidase-like 49	68.900%	Swiss-Prot	High
`P52712`	Oryza sativa subsp. japonica	sp\|P52712\|CBPX_ORYSJ Serine carboxypeptidase-like	74.900%	Swiss-Prot	High
`P37891`	Oryza sativa subsp. japonica	sp\|P37891\|CBP3_ORYSJ Serine carboxypeptidase 3	65.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card