TkA04G200800 | RubberDandelionOmics

Gene overview

TkA04G200800

Reference: TK1151 Chr: Chr04 Coordinates: 51667593-51668681 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

691 bp · TkA04G200800|TK1151|cDNA

ATACGAAATGATAAGGCTAAAAGATACTTAAACGGGTTGCCAAACAAAGTCAAAGTTCCGTTATCAAATAAGTTCCCAAATGCCGATCCATTAGCACTTCGTTTACTTGAAAAATTGCTTGCGTTTGACCCTGCTGACCGGATCTCTGCTGAAGAGATAAGCTTTAGCATTAGCGGATCCGTATTTTTATGGTTTAGCGGATTGGGAAACCGAACCATCAAAACAACCATTTTCAAAACTTGAATTTGATTTTGAAAATC...

CDS

Download CDS FASTA

366 bp · TkA04G200800|TK1151|CDS

ATGTTGCAAGAATACCTCCATGGCGAGGAACACATAGGCTTCATGTACCCAAGTGGAATTGATCGATTTAAGCAGCAATTTGCGAATCTTGAAGAGCAGGAGGGCAAAGGAGGAAGAAACTCTCCACTTAGAAGGCAATACACGTCATTGCCAAGAGAGCGGATATGTGTGCCAATAGAAGAAGCAGTAGATGAAATGAATGAGTTTGAAAGGCGCACAAATGCTGTAATTGCCAAATCACTTCGAAGCCCACCAAGATC...

Protein

Download Protein FASTA

122 aa · TkA04G200800|TK1151|PROTEIN

MLQEYLHGEEHIGFMYPSGIDRFKQQFANLEEQEGKGGRNSPLRRQYTSLPRERICVPIEEAVDEMNEFERRTNAVIAKSLRSPPRSSERTKNVNKKDSKNIPNPKTMSRSSSINNTTKYVG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G200800`
TK1151 ID	TkA04G200800
OH-1004 ID	LXL04_007816
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	78.700
Protein coverage (%)	TK1151 100.000 / OH-1004 50.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G200800

Location Chr04:51667593-51668681 (+)

Description Similar to MPK13: Mitogen-activated protein kinase 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73670`	Mitogen-activated protein kinase 15.	No verified direct reference in this release
`At3g18040`	Mitogen-activated protein kinase 9.	No verified direct reference in this release
`At1g18150`	MKK3-MPK8 and CAMs-MPK8 modules negatively regulates ROS accumulation through controlling expression of the RBOHD gene during wounding.	Calmodulin-dependent activation of MAP kinase for ROS homeostasis in Arabidopsis.2011 · DOI: 10.1016/j.molcel.2011.02.029

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X0M1`	Mitogen-activated protein kinase 13.	No verified direct reference in this release
`Os02g0135200`	Mitogen-activated protein kinase 13.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007816 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004707 MAP kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G73670

ath:AT3G18040

dosa:Os02g0135200

dosa:Os06g0708000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.536

Rank 1 · TkA04G200800 · TK1151

Nucleus0.361

Rank 2 · TkA04G200800 · TK1151

Cell membrane0.106

Rank 3 · TkA04G200800 · TK1151

Mitochondrion0.078

Rank 4 · TkA04G200800 · TK1151

Golgi apparatus0.034

Rank 5 · TkA04G200800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9U4`	Arabidopsis thaliana	sp\|Q9C9U4\|MPK15_ARATH Mitogen-activated protein kinase 15	55.300%	Swiss-Prot	Medium
`Q9LV37`	Arabidopsis thaliana	sp\|Q9LV37\|MPK9_ARATH Mitogen-activated protein kinase 9	55.200%	Swiss-Prot	High
`Q9LM33`	Arabidopsis thaliana	sp\|Q9LM33\|MPK8_ARATH Mitogen-activated protein kinase 8	51.100%	Swiss-Prot	Medium
`A2X0M1`	Oryza sativa subsp. indica	sp\|A2X0M1\|MPK13_ORYSI Mitogen-activated protein kinase 13	53.800%	Swiss-Prot	High
`Q0E459`	Oryza sativa subsp. japonica	sp\|Q0E459\|MPK13_ORYSJ Mitogen-activated protein kinase 13	53.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card