TkA04G188950 | RubberDandelionOmics

Gene overview

TkA04G188950

Reference: TK1151 Chr: Chr04 Coordinates: 48706607-48708814 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1343 bp · TkA04G188950|TK1151|cDNA

GTCTCCTCAAATTTTGATGCCTCCCTCTTCTCCATCTCAATTTGATTCATCAGAAACAAACCCAAATCGAGGAGATAGATCGTGAATGAGACAAGAAACGGCCCGAATTAAACAAGAAACGAATGCAAAACGCTTCTCGATCATGAATCCAATTCGATACATGCTACGCGAACAGAGGATCCCATGTCTGCTGATCGGAATCGCCATTCCAGCTCTGCTGTTCAACGTTTCTATTCCCTTACCTTCACCGCTGCAAGTTG...

CDS

Download CDS FASTA

918 bp · TkA04G188950|TK1151|CDS

ATGAGGTTCATGCCAAAGGATCGTATAACATTAATATTGGAGGAAGAATCCCATTGGGTTAAAGACAAAAGCCAAAGGGTTCTGGTTACAGGTGGGGCTGGGTTTGTGGGAAGCCATCTGGTGGATCGTCTGTTAGCACGCGGTGATAGTGTAATCGTAGTTGATAACTTTTTCACAGGAAGAAAAGACAACCTGCTGCATCATCTTCGAAACCCAAGGGATCACAAGACTAACGTGGTGGGAACGTTAAATATGCTTGG...

Protein

Download Protein FASTA

305 aa · TkA04G188950|TK1151|PROTEIN

MRFMPKDRITLILEEESHWVKDKSQRVLVTGGAGFVGSHLVDRLLARGDSVIVVDNFFTGRKDNLLHHLRNPRDHKTNVVGTLNMLGLAKRINARFLLTSTSEVYGDPLEHPQVETYWGNVNPIGVRSCYDEGKRVAETLTMDYHRGLNIEVRIARIFNTYGPRMCLDDGRVVSNFVAQALRKEPMTVYGDGLQTRSFQYVSDLVEGLMRLMEGEHVGPFNLGNPSEFTMLELAKVVQETIDPNARIEFRPNTEDDPHKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G188950`
TK1151 ID	TkA04G188950
OH-1004 ID	LXL04_029886
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.400
Protein coverage (%)	TK1151 93.770 / OH-1004 76.555 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G188950

Location Chr04:48706607-48708814 (+)

Description Similar to UXS2: UDP-glucuronic acid decarboxylase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62830`	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose.	Biosynthesis of UDP-xylose: characterization of membrane-bound AtUxs2.2005 · DOI: 10.1007/s00425-004-1471-7
`At2g47650`	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose.	No verified direct reference in this release
`At3g53520`	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose.	No verified direct reference in this release
`At2g28760`	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose.	No verified direct reference in this release
`At3g46440`	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029886 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019305 dTDP-rhamnose biosynthetic process Biological Process

GO:0033320 UDP-D-xylose biosynthetic process Biological Process

GO:0042732 D-xylose metabolic process Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G28760

ath:AT2G47650

ath:AT3G46440

ath:AT3G53520

ath:AT3G62830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.525

Rank 1 · TkA04G188950 · TK1151

Nucleus0.264

Rank 2 · TkA04G188950 · TK1151

Mitochondrion0.167

Rank 3 · TkA04G188950 · TK1151

Plastid0.136

Rank 4 · TkA04G188950 · TK1151

Peroxisome0.106

Rank 5 · TkA04G188950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04321RmlD_sub_bind26-54 aa

PF00106adh_short26-56 aa

PF01370Epimerase27-68 aa

PF02719Polysacc_synt_227-53 aa

PF08659KR27-54 aa

PF16363GDP_Man_Dehyd28-74 aa

PF010733Beta_HSD28-55 aa

PF07993NAD_binding_429-51 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G188950	`PF04321`	RmlD_sub_bind	26	54	2e-07	31.1
TkA04G188950	`PF00106`	adh_short	26	56	0.3	11.2
TkA04G188950	`PF01370`	Epimerase	27	68	2.1e-38	132.8
TkA04G188950	`PF02719`	Polysacc_synt_2	27	53	0.0063	16.5
TkA04G188950	`PF08659`	KR	27	54	0.38	11.4
TkA04G188950	`PF16363`	GDP_Man_Dehyd	28	74	1.6e-46	160.0
TkA04G188950	`PF01073`	3Beta_HSD	28	55	4e-07	30.1
TkA04G188950	`PF07993`	NAD_binding_4	29	51	1.3e-08	35.1
TkA04G188950	`PF01073`	3Beta_HSD	72	143	4e-07	30.1
TkA04G188950	`PF04321`	RmlD_sub_bind	73	252	2e-07	31.1
TkA04G188950	`PF01370`	Epimerase	75	223	2.1e-38	132.8
TkA04G188950	`PF16363`	GDP_Man_Dehyd	76	284	1.6e-46	160.0
TkA04G188950	`PF07993`	NAD_binding_4	76	157	1.3e-08	35.1
TkA04G188950	`PF02719`	Polysacc_synt_2	76	101	0.0063	16.5
TkA04G188950	`PF02719`	Polysacc_synt_2	130	239	0.0063	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZI2`	Arabidopsis thaliana	sp\|Q9LZI2\|UXS2_ARATH UDP-glucuronic acid decarboxylase 2	77.300%	Swiss-Prot	High
`Q8S8T4`	Arabidopsis thaliana	sp\|Q8S8T4\|UXS4_ARATH UDP-glucuronic acid decarboxylase 4	76.100%	Swiss-Prot	High
`Q8VZC0`	Arabidopsis thaliana	sp\|Q8VZC0\|UXS1_ARATH UDP-glucuronic acid decarboxylase 1	70.400%	Swiss-Prot	High
`Q9ZV36`	Arabidopsis thaliana	sp\|Q9ZV36\|UXS6_ARATH UDP-glucuronic acid decarboxylase 6	63.100%	Swiss-Prot	High
`Q9SN95`	Arabidopsis thaliana	sp\|Q9SN95\|UXS5_ARATH UDP-glucuronic acid decarboxylase 5	61.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card