TkA04G188700 | RubberDandelionOmics

Gene overview

TkA04G188700

Reference: TK1151 Chr: Chr04 Coordinates: 48631306-48634106 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1463 bp · TkA04G188700|TK1151|cDNA

GTTAGACGGCCCAAAACGCAGAAAGAAACCCTTTATAAAACCCTAGAGCACATAACCTTTTCAAACTTTTTGGTCGGATCAATTTCTTTCGCTCACTCGTTCCTCTTCACGGGATTCAGTCATTCAGGTCATTTCCTTATCAAAACCCTAGCGAATCCCTCCGTCACAAACATGGCGTCCAACTCCCCGAATCTCGAGTGCCGTATGTACGAAGCCAAGTTTCCCGACGTCGACATGGCCGTCATGATTCAAGTCAAGAG...

CDS

Download CDS FASTA

1197 bp · TkA04G188700|TK1151|CDS

GTTAGACGGCCCAAAACGCAGAAAGAAACCCTTTATAAAACCCTAGAGCACATAACCTTTTCAAACTTTTTGGTCGGATCAATTTCTTTCGCTCACTCGTTCCTCTTCACGGGATTCAGTCATTCAGGTCATTTCCTTATCAAAACCCTAGCGAATCCCTCCGTCACAAACATGGCGTCCAACTCCCCGAATCTCGAGTGCCGTATGTACGAAGCCAAGTTTCCCGACGTCGACATGGCCGTCATGATTCAAGTCAAGAG...

Protein

Download Protein FASTA

398 aa · TkA04G188700|TK1151|PROTEIN

VRRPKTQKETLYKTLEHITFSNFLVGSISFAHSFLFTGFSHSGHFLIKTLANPSVTNMASNSPNLECRMYEAKFPDVDMAVMIQVKSIGEMCAYVSLLEYNNIEGMILLSELSRRRIRSINSLIKVGRTEPVMVLHVDEEKGYVNLSKRRVSEEDIQICEDRYNKSKLVHSIMRHVAETMQLDLEDLYVHVGWPLYRKYGHCFEAFKLIVNDPDSILNTLTREVKETGPDGVEVTKVVPALTEEVKDALVKNIRRRMTPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G188700`
TK1151 ID	TkA04G188700
OH-1004 ID	LXL04_029889
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.400
Protein coverage (%)	TK1151 83.668 / OH-1004 50.075 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G188700

Location Chr04:48631306-48634106 (+)

Description Similar to At2g40290: Eukaryotic translation initiation factor 2 subunit alpha homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40290`	Functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA.	No verified direct reference in this release
`At5g05470`	Functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029889 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002183 cytoplasmic translational initiation Biological Process

GO:0006413 translational initiation Biological Process

GO:0006417 regulation of translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005850 eukaryotic translation initiation factor 2 complex Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0033290 eukaryotic 48S preinitiation complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G40290

ath:AT5G05470

spo:2543455

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.570

Rank 1 · TkA04G188700 · TK1151

Nucleus0.433

Rank 2 · TkA04G188700 · TK1151

Endoplasmic reticulum0.056

Rank 3 · TkA04G188700 · TK1151

Mitochondrion0.054

Rank 4 · TkA04G188700 · TK1151

Cell membrane0.052

Rank 5 · TkA04G188700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23459S1_RRP518-32 aa

PF23459S1_RRP578-147 aa

PF21710Spt6_S180-149 aa

PF13221DUF402982-125 aa

PF00575S184-149 aa

PF07541EIF_2_alpha187-317 aa

PF21710Spt6_S1216-246 aa

PF13221DUF4029307-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G188700	`PF23459`	S1_RRP5	18	32	0.031	15.5
TkA04G188700	`PF23459`	S1_RRP5	78	147	0.031	15.5
TkA04G188700	`PF21710`	Spt6_S1	80	149	0.042	14.8
TkA04G188700	`PF13221`	DUF4029	82	125	0.27	12.6
TkA04G188700	`PF00575`	S1	84	149	6.6e-11	43.1
TkA04G188700	`PF07541`	EIF_2_alpha	187	317	2.7e-33	115.0
TkA04G188700	`PF21710`	Spt6_S1	216	246	0.042	14.8
TkA04G188700	`PF13221`	DUF4029	307	331	0.27	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIZ2`	Arabidopsis thaliana	sp\|Q9SIZ2\|IF2AH_ARATH Eukaryotic translation initiation factor 2 subunit alpha homolog	79.500%	Swiss-Prot	High
`Q9FE78`	Arabidopsis thaliana	sp\|Q9FE78\|IF2A_ARATH Eukaryotic translation initiation factor 2 subunit alpha	75.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card