TkA04G188650 | RubberDandelionOmics

Gene overview

TkA04G188650

Reference: TK1151 Chr: Chr04 Coordinates: 48607368-48618621 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1441 bp · TkA04G188650|TK1151|cDNA

GTTCGTTGCTTGTTCAATGGTAGGAAATTTCTTGAAAATGTGTAACATGTGCCATGAATTATTGGGTTTTGTTAAAAAGTGTTCTTTTGAGAAAACCGTGAGTGACGGCTAACATTATTTTCCACTAAAAAAGCAATTTTGTTCATTCGAGTTCAATCTCAAATCGAAACCCATAGCCATAGCCAAAACCCCTAAAATCTTCCAGAACCCCATTCAACCATGTCAACAGCATCCCCCCCAAATTTCGATTGCCGCATGTA...

CDS

Download CDS FASTA

1044 bp · TkA04G188650|TK1151|CDS

ATGTCAACAGCATCCCCCCCAAATTTCGATTGCCGCATGTACGAAGCCAAGTTTCCGGAGGTTGACACGCCGGTGATGATCCAGGTCAAGGAAATCGGAGATGTTGCCACTCATGTCTCTCTCCTTGAATACAACAACATCGAAGGGATGATCCTCTTATCGGATCTCTCTCGCCGCCGTATTCGAAGTGTTGGCAGCTTAATCAAAGTAGGCCGCATCGAGCCTGCTATGGTGCTTCGTGTTAATGCCGAGAAAGGATA...

Protein

Download Protein FASTA

347 aa · TkA04G188650|TK1151|PROTEIN

MSTASPPNFDCRMYEAKFPEVDTPVMIQVKEIGDVATHVSLLEYNNIEGMILLSDLSRRRIRSVGSLIKVGRIEPAMVLRVNAEKGYIDLSKKRLSEQDVQICEERYSKSKLVHSIMRHVAETMNVDLEDLYIHVGWPLYRKYGHAFEAFKLIVNDPDSILKSLTREVKHIGQDGKEVTKVLPALSEDVKDSLVRNIRRRMTPQPLKIRADIEMKCFQFDGVLHIKEAMRQAEAVGTKDCPVKIKLVAPPSYVLNTQTLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G188650`
TK1151 ID	TkA04G188650
OH-1004 ID	LXL04_029889
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 98.559 / OH-1004 51.274 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G188650

Location Chr04:48607368-48618621 (-)

Description Similar to At2g40290: Eukaryotic translation initiation factor 2 subunit alpha homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40290`	Functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA.	No verified direct reference in this release
`At5g05470`	Functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029889 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002183 cytoplasmic translational initiation Biological Process

GO:0006413 translational initiation Biological Process

GO:0006417 regulation of translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005850 eukaryotic translation initiation factor 2 complex Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0033290 eukaryotic 48S preinitiation complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G40290

ath:AT5G05470

spo:2543455

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.540

Rank 1 · TkA04G188650 · TK1151

Nucleus0.514

Rank 2 · TkA04G188650 · TK1151

Cell membrane0.043

Rank 3 · TkA04G188650 · TK1151

Mitochondrion0.039

Rank 4 · TkA04G188650 · TK1151

Endoplasmic reticulum0.036

Rank 5 · TkA04G188650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00575S129-93 aa

PF22458RsmF-B_ferredox70-109 aa

PF29410CFAP70_helical76-134 aa

PF07541EIF_2_alpha131-261 aa

PF00575S1220-238 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G188650	`PF00575`	S1	29	93	7.1e-07	30.2
TkA04G188650	`PF22458`	RsmF-B_ferredox	70	109	0.083	13.8
TkA04G188650	`PF29410`	CFAP70_helical	76	134	0.25	12.4
TkA04G188650	`PF07541`	EIF_2_alpha	131	261	2.4e-33	115.2
TkA04G188650	`PF00575`	S1	220	238	7.1e-07	30.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIZ2`	Arabidopsis thaliana	sp\|Q9SIZ2\|IF2AH_ARATH Eukaryotic translation initiation factor 2 subunit alpha homolog	75.000%	Swiss-Prot	High
`Q9FE78`	Arabidopsis thaliana	sp\|Q9FE78\|IF2A_ARATH Eukaryotic translation initiation factor 2 subunit alpha	71.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card