Gene Card
Gene overview
cDNA / CDS / Protein Sequences
381 bp · TkA04G187850|TK1151|cDNA
AAGAGAAGTTTAGGATGCAAACCGGCTCACAGTGAGTTTTTCTTGTATACACACACAAAAAATCTTGACGGAGAAAATTTTATAACTGAAAAAGCGATATATTCATCGGCTTCTTATTTGGAAAAACGCGAAGAATTAGAAGCAACAGGAGAAAATGTAGATGATGACTCCATCTTTTATGAAGTTTTTAGAGGTCATGAGCAAAAAAGAAGGCTGTATGGTTTTGGGTCGTATGGAAAAGTGATTCCATCAAAAAAGGG...
381 bp · TkA04G187850|TK1151|CDS
AAGAGAAGTTTAGGATGCAAACCGGCTCACAGTGAGTTTTTCTTGTATACACACACAAAAAATCTTGACGGAGAAAATTTTATAACTGAAAAAGCGATATATTCATCGGCTTCTTATTTGGAAAAACGCGAAGAATTAGAAGCAACAGGAGAAAATGTAGATGATGACTCCATCTTTTATGAAGTTTTTAGAGGTCATGAGCAAAAAAGAAGGCTGTATGGTTTTGGGTCGTATGGAAAAGTGATTCCATCAAAAAAGGG...
Protein
Download Protein FASTA126 aa · TkA04G187850|TK1151|PROTEIN
KRSLGCKPAHSEFFLYTHTKNLDGENFITEKAIYSSASYLEKREELEATGENVDDDSIFYEVFRGHEQKRRLYGFGSYGKVIPSKKGSNDTYYTPETNASKELSKKNAKLAQMKELVTSQKKKKNN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G187850 |
|---|---|
| TK1151 ID | TkA04G187850 |
| OH-1004 ID | LXL04_024862 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 77.500 |
| Protein coverage (%) | TK1151 70.635 / OH-1004 29.766Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G187850 |
|---|---|
| Location | Chr04:48420239-48420706 (-) |
| Description | Similar to SPCC1672.07: U3 small nucleolar RNA-associated protein 21 homolog (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006364 rRNA processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0032153 cell division site Cellular Component GO:0034388 Pwp2p-containing subcomplex of 90S preribosome Cellular Component GO:0072686 mitotic spindle Cellular Component GO:0003723 RNA binding Molecular Function |
| KEGG gene cross-reference | hsa:134430 spo:2539299 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.