TkA04G181150 | RubberDandelionOmics

Gene overview

TkA04G181150

Reference: TK1151 Chr: Chr04 Coordinates: 46926069-46933484 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1484 bp · TkA04G181150|TK1151|cDNA

AAATAAGCAAAACAAAAAAACAAATAATATAATCCACTTGCTAAATACAAGAGAATAACCTGGACACAAACAACTCCTCCATATAAGCAGAGATCACGTCTCTTACTCCACACGCACATCATCCTCTCAAATTCTAAAATCTCTCTGTTATTCTTAATAAACCTTTTCGAGATTCTTTACAACAAACTTTTTCTATCTGTCTCTCTATCATCGCCTTAATTTCAGGAATAATCCAAAGCTTGTGATCTTCTTAAAGATTT...

CDS

Download CDS FASTA

972 bp · TkA04G181150|TK1151|CDS

ATGGCGACTGAAGCTTCAGATTTCAAATACGAAGAGGAATTTATCACGAATTCTAAAGGATTGCAGCTTTTTACGTGTCGATGGCTTCCTGTTGACACTGAACCAAAAGCTTTGATCTTTCTTAACCATGGCTATGCCATGGAATGCAGTGTCTCCATGAAAGGAGCTGCATTACGGCTTGTGAAGGCGGGATTTGCAGTTTATGGAATTGATAATCAAGGCCATGGGAAATCTTCTGGGCTTCAGGGTTATATCCCATC...

Protein

Download Protein FASTA

323 aa · TkA04G181150|TK1151|PROTEIN

MATEASDFKYEEEFITNSKGLQLFTCRWLPVDTEPKALIFLNHGYAMECSVSMKGAALRLVKAGFAVYGIDNQGHGKSSGLQGYIPSFDDLVNDCSDFFTSVCERKENKRKMRILLGESMGGGMVLLLHRKNPEYWDGGVLVAPMCKIADDMKPPQLVINVLTKLTKIIPTWKIVPGQDIIDVAFRDPKVREEVRNNPLCYKGRLRLKTANELLTVSSDLENRLQEVTFPFFVGHGEADKVTDPSVSKLLYETAASYEKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G181150`
TK1151 ID	TkA04G181150
OH-1004 ID	LXL04_001149
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.200
Protein coverage (%)	TK1151 89.783 / OH-1004 92.628 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G181150`
Location	Chr04:46926069-46933484 (-)
Description	Similar to CSE: Caffeoylshikimate esterase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001149` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0006633 fatty acid biosynthetic process Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009809 lignin biosynthetic process Biological Process GO:0009966 regulation of signal transduction Biological Process GO:0010043 response to zinc ion Biological Process GO:0016042 lipid catabolic process Biological Process GO:0019369 arachidonate metabolic process Biological Process GO:0019433 triglyceride catabolic process Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0045471 response to ethanol Biological Process GO:0045907 positive regulation of vasoconstriction Biological Process
KEGG gene cross-reference	ath:AT1G52760 hsa:11343 mmu:23945 msg:MSMEI_0213 msm:MSMEG_0220 rno:29254 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.376

Rank 1 · TkA04G181150 · TK1151

Endoplasmic reticulum0.325

Rank 2 · TkA04G181150 · TK1151

Cell membrane0.168

Rank 3 · TkA04G181150 · TK1151

Mitochondrion0.150

Rank 4 · TkA04G181150 · TK1151

Nucleus0.139

Rank 5 · TkA04G181150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146Hydrolase_434-272 aa

PF00561Abhydrolase_139-162 aa

PF12697Abhydrolase_639-269 aa

PF01738DLH44-69 aa

PF02230Abhydrolase_267-136 aa

PF00326Peptidase_S992-155 aa

PF01738DLH94-140 aa

PF00756Esterase108-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G181150	`PF12146`	Hydrolase_4	34	272	1e-65	222.1
TkA04G181150	`PF00561`	Abhydrolase_1	39	162	8.5e-09	36.1
TkA04G181150	`PF12697`	Abhydrolase_6	39	269	2.3e-06	29.1
TkA04G181150	`PF01738`	DLH	44	69	0.16	12.2
TkA04G181150	`PF02230`	Abhydrolase_2	67	136	0.0088	16.6
TkA04G181150	`PF00326`	Peptidase_S9	92	155	0.0019	18.5
TkA04G181150	`PF01738`	DLH	94	140	0.16	12.2
TkA04G181150	`PF00756`	Esterase	108	147	0.061	13.8
TkA04G181150	`PF02230`	Abhydrolase_2	216	276	0.0088	16.6
TkA04G181150	`PF00326`	Peptidase_S9	221	292	0.0019	18.5
TkA04G181150	`PF01738`	DLH	222	271	0.16	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card