TkA04G175100 | RubberDandelionOmics

Gene overview

TkA04G175100

Reference: TK1151 Chr: Chr04 Coordinates: 45347032-45350238 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1878 bp · TkA04G175100|TK1151|cDNA

GTAAAACATGGGAAAAAGTGGTAGTACAAACCAGTCAAACTTGGCAACAGTATTAAAGACGATGATATCTTGCGAGAATTTAGCAAATAAAGTGCTGCTGTGTCTGTTTCTGTTCCTCAGATGCGAAAACTAAAAATCTTCACTGGATTCCATTAATCATGGTCACCTTTCTCTTTTCTGGAAACAGTTAAACAACATTCTTTATAAAATTGAAAAAAATACATACGACAAGGAGCTTGCAGCGAAGAATTAACGGGGAG...

CDS

Download CDS FASTA

1167 bp · TkA04G175100|TK1151|CDS

ATGGGTTCCTGTTTCAGTGTCCGATTGAAAATCGAAAGTTCTCGGCTTGATGGTAAGGTGACATCTGCGTCGGTACCCCCAAGCCCTCGAAGCCCAAGAAGTCAAGCTGAGATTTTGCAGTCAGCAAATTTAAAGTCGTTTAGTTTTAACGTTCTTAAAACAGCCACCAGAAATTTCCGACCCGATAGTGTGTTGGGTGAAGGTGGGTTCGGGTCGGTTTTCAAAGGGTGGATCGATGAACAATCACTGGCAGCTGCAAA...

Protein

Download Protein FASTA

388 aa · TkA04G175100|TK1151|PROTEIN

MGSCFSVRLKIESSRLDGKVTSASVPPSPRSPRSQAEILQSANLKSFSFNVLKTATRNFRPDSVLGEGGFGSVFKGWIDEQSLAAAKPGTGTVIAVKRLNHEGIQGHQEWLAEINYLGQLNHQNLVKLIGYCLEDDHRMLVYEFMPRGSLENHLFRRSSYFQPLSWNLRIKVALGAAKGLAYLHSPEAKVIYRDFKSSNILIDSNYNAKLSDFGLAKDGPIDGKSHVSTRVMGTQGYAAPEYMATGHLTARSDIYSFGVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G175100`
TK1151 ID	TkA04G175100
OH-1004 ID	LXL04_021933
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.800
Protein coverage (%)	TK1151 100.000 / OH-1004 99.217 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G175100

Location Chr04:45347032-45350238 (+)

Description Similar to PBL9: Probable serine/threonine-protein kinase PBL9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07570`	Possible bi-functional kinase.	Novel protein kinase of Arabidopsis thaliana (APK1) that phosphorylates tyrosine, serine and threonine.1992 · DOI: 10.1007/bf00046450
`At5g02290`	May play a role in the regulation of plant growth and development (Probable).	No verified direct reference in this release
`At2g28930`	Possible bi-functional kinase.	Light-induced stomatal opening is affected by the guard cell protein kinase APK1b.2014 · DOI: 10.1371/journal.pone.0097161
`At2g39660`	Plays a central role in immune responses.	The membrane-anchored BOTRYTIS-INDUCED KINASE1 plays distinct roles in Arabidopsis resistance to necrotrophic and biotrophic pathogens.2006 · DOI: 10.1105/tpc.105.035576 Phosphorylation of receptor-like cytoplasmic kinases by bacterial flagellin.2010 · DOI: 10.4161/psb.11500 Receptor-like cytoplasmic kinases integrate signaling from multiple plant immune receptors and are targeted by a Pseudomonas syringae effector.2010 · DOI: 10.1016/j.chom.2010.03.007 A Xanthomonas uridine 5'-monophosphate transferase inhibits plant immune kinases.2012 · DOI: 10.1038/nature10962 BIK1 interacts with PEPRs to mediate ethylene-induced immunity.2013 · DOI: 10.1073/pnas.1215543110 Inverse modulation of plant immune and brassinosteroid signaling pathways by the receptor-like cytoplasmic kinase BIK1.2013 · DOI: 10.1073/pnas.1302154110 Identification and functional analysis of phosphorylation residues of the Arabidopsis BOTRYTIS-INDUCED KINASE1.2013 · DOI: 10.1007/s13238-013-3053-6 The FLS2-associated kinase BIK1 directly phosphorylates the NADPH oxidase RbohD to control plant immunity.2014 · DOI: 10.1016/j.chom.2014.02.009 Microbe-associated molecular pattern-induced calcium signaling requires the receptor-like cytoplasmic kinases, PBL1 and BIK1.2014 · DOI: 10.1186/s12870-014-0374-4 Regulatory role of BOTRYTIS INDUCED KINASE1 in ETHYLENE INSENSITIVE3-dependent gene expression in Arabidopsis.2015 · DOI: 10.1007/s00299-015-1812-y The Decoy Substrate of a Pathogen Effector and a Pseudokinase Specify Pathogen-Induced Modified-Self Recognition and Immunity in Plants.2015 · DOI: 10.1016/j.chom.2015.08.004 The MAP4 Kinase SIK1 Ensures Robust Extracellular ROS Burst and Antibacterial Immunity in Plants.2018 · DOI: 10.1016/j.chom.2018.08.007 Ligand-induced monoubiquitination of BIK1 regulates plant immunity.2020 · DOI: 10.1038/s41586-020-2210-3 The calcium-permeable channel OSCA1.3 regulates plant stomatal immunity.2020 · DOI: 10.1038/s41586-020-2702-1 The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0110900`	Functions downstream of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	OsCERK1 and OsRLCK176 play important roles in peptidoglycan and chitin signaling in rice innate immunity.2014 · DOI: 10.1111/tpj.12710

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021933 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009620 response to fungus Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0080141 regulation of jasmonic acid biosynthetic process Biological Process

GO:0080142 regulation of salicylic acid biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G07570

ath:AT2G28930

ath:AT2G39660

ath:AT5G02290

dosa:Os05g0110900

osa:4337593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.667

Rank 1 · TkA04G175100 · TK1151

Cytoplasm0.266

Rank 2 · TkA04G175100 · TK1151

Nucleus0.259

Rank 3 · TkA04G175100 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA04G175100 · TK1151

Golgi apparatus0.025

Rank 5 · TkA04G175100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase62-339 aa

PF07714PK_Tyr_Ser-Thr63-341 aa

PF02755RPEL330-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G175100	`PF00069`	Pkinase	62	339	9.7e-48	163.6
TkA04G175100	`PF07714`	PK_Tyr_Ser-Thr	63	341	2.7e-46	158.7
TkA04G175100	`PF02755`	RPEL	330	339	0.18	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q06548`	Arabidopsis thaliana	sp\|Q06548\|PBL9_ARATH Probable serine/threonine-protein kinase PBL9	62.300%	Swiss-Prot	High
`P43293`	Arabidopsis thaliana	sp\|P43293\|PBL11_ARATH Probable serine/threonine-protein kinase PBL11	61.300%	Swiss-Prot	High
`P46573`	Arabidopsis thaliana	sp\|P46573\|PBL10_ARATH Probable serine/threonine-protein kinase PBL10	66.200%	Swiss-Prot	High
`O48814`	Arabidopsis thaliana	sp\|O48814\|BIK1_ARATH Serine/threonine-protein kinase BIK1	63.800%	Swiss-Prot	High
`Q65XV8`	Oryza sativa subsp. japonica	sp\|Q65XV8\|RK176_ORYSJ Receptor-like cytoplasmic kinase 176	65.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card