Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2372 bp · TkA04G174700|TK1151|cDNA
ATAGTTTTGTTAATTTTGTGAAAATAACCCAATTGAAATCCTAAATAAACTTAAAAAGAGTAAAATGGATTCCTACCCTTCCTTTTACTCACAGATTAAATGCATTCCCTTTTACTAGGAAAATGACATATTACAAAAATAACCATCTTAACCATCGCAAACCTATTCTCAGTTTCTGACGCTTAAACCCTTAAGCCCTTCCTCGCTTTCTCCATCTTACAGCCGGCGCTAAATACTCTTCTCCATCTCCGCACCCGGCT...
1731 bp · TkA04G174700|TK1151|CDS
ATGGCTGCTAAAGGCAAAATGTCACAAAAGAAAGCAAGCAGAAAGGAGCAAAGTAAGGAGGTTGTTTCTGTCAAAAGTAAAAAGAAGAATGAGATTGTGAGCGAGTCTGAGTCTGATAGTGATGACGGAGGGGATTCGGGGTCTGAATTGTCGTTGGATACATTGGGAGACGTTTTTTCACAAGGCGGCGATGATGAAGATATGGGGTCGGGGTCAGGTTTGGATTCTGATTCTGATTCTGATGATGATGCTGAGAAGAA...
Protein
Download Protein FASTA576 aa · TkA04G174700|TK1151|PROTEIN
MAAKGKMSQKKASRKEQSKEVVSVKSKKKNEIVSESESDSDDGGDSGSELSLDTLGDVFSQGGDDEDMGSGSGLDSDSDSDDDAEKKSKAIDEAKEMEEKEGEQELQLNIKEQPDEFRLPTHEELEEEARGPPDLTGLQQRIKEIVRILSNFGNLRQEGATRKEYVEQLKLDLGSYYGYNEFLISSFVEMFPPVELMELIEAFEKPRPVTLRTNTLKTRRRDLAGVLLNRGINLDPLSKWSKVGLVVYDHQVPYGATPEY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G174700 |
|---|---|
| TK1151 ID | TkA04G174700 |
| OH-1004 ID | LXL04_035052 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 96.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G174700 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:45219547-45223059 (+) | |||||||||
| Description | Similar to NOP2B: 26S rRNA (cytosine-C(5))-methyltransferase NOP2B | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000027 ribosomal large subunit assembly Biological Process GO:0000470 maturation of LSU-rRNA Biological Process GO:0006364 rRNA processing Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0010015 root morphogenesis Biological Process GO:0040018 positive regulation of multicellular organism growth Biological Process GO:0042127 regulation of cell population proliferation Biological Process GO:0042273 ribosomal large subunit biogenesis Biological Process GO:0045727 positive regulation of translation Biological Process GO:0051301 cell division Biological Process GO:0070475 rRNA base methylation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT4G26600 ath:AT5G55920 cel:CELE_W07E6.1 hsa:4839 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01728FtsJ87-134 aaPF13847Methyltransf_3188-103 aaPF22458RsmF-B_ferredox160-170 aaPF22458RsmF-B_ferredox181-246 aaPF17125Methyltr_RsmF_N190-270 aaPF01189Methyltr_RsmB-F276-486 aaPF01728FtsJ283-415 aaPF13847Methyltransf_31283-419 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G174700 | PF01728 | FtsJ | 87 | 134 | 0.012 | 16.3 |
| TkA04G174700 | PF13847 | Methyltransf_31 | 88 | 103 | 0.019 | 15.5 |
| TkA04G174700 | PF22458 | RsmF-B_ferredox | 160 | 170 | 1.4e-05 | 25.9 |
| TkA04G174700 | PF22458 | RsmF-B_ferredox | 181 | 246 | 1.4e-05 | 25.9 |
| TkA04G174700 | PF17125 | Methyltr_RsmF_N | 190 | 270 | 2.2e-07 | 31.9 |
| TkA04G174700 | PF01189 | Methyltr_RsmB-F | 276 | 486 | 2e-69 | 234.0 |
| TkA04G174700 | PF01728 | FtsJ | 283 | 415 | 0.012 | 16.3 |
| TkA04G174700 | PF13847 | Methyltransf_31 | 283 | 419 | 0.019 | 15.5 |
| TkA04G174700 | PF29631 | EnP1_N | 318 | 354 | 0.12 | 13.2 |
| TkA04G174700 | PF29631 | EnP1_N | 402 | 437 | 0.12 | 13.2 |
| TkA04G174700 | PF17125 | Methyltr_RsmF_N | 497 | 534 | 2.2e-07 | 31.9 |
| TkA04G174700 | PF13847 | Methyltransf_31 | 524 | 526 | 0.019 | 15.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.