TkA04G173670 | RubberDandelionOmics

Gene overview

TkA04G173670

Reference: TK1151 Chr: Chr04 Coordinates: 44925836-44926840 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · TkA04G173670|TK1151|cDNA

ATGGCGAATAGATGGTGGGCTGGAAATGTAGGATTGAATCATCAGATGTCATCGTCGGGACAACCGCCGTCGCTACACGTGAGGGACACGGCGGAGGAGGAGAAGCCACGGTCGAACAGGGAACACAATAATGTCGGAGGAGGAGGGTCGTTGGAGATCTCGGAGCCGACGAGCTCTGGTGGTGGTCGGAGGCCGCGAGGGAGGCCACCTGGTTCGAAAAACAAGCCCAAACCACCGATTGTGATCACGAAAGAGAGCCC...

CDS

Download CDS FASTA

825 bp · TkA04G173670|TK1151|CDS

ATGGCGAATAGATGGTGGGCTGGAAATGTAGGATTGAATCATCAGATGTCATCGTCGGGACAACCGCCGTCGCTACACGTGAGGGACACGGCGGAGGAGGAGAAGCCACGGTCGAACAGGGAACACAATAATGTCGGAGGAGGAGGGTCGTTGGAGATCTCGGAGCCGACGAGCTCTGGTGGTGGTCGGAGGCCGCGAGGGAGGCCACCTGGTTCGAAAAACAAGCCCAAACCACCGATTGTGATCACGAAAGAGAGCCC...

Protein

Download Protein FASTA

274 aa · TkA04G173670|TK1151|PROTEIN

MANRWWAGNVGLNHQMSSSGQPPSLHVRDTAEEEKPRSNREHNNVGGGGSLEISEPTSSGGGRRPRGRPPGSKNKPKPPIVITKESPNALRSHVLEISSGSDISECIATFAQRRHRGVSVLSGSGIVTNVTLRQPAAPGGVLTLQGRFEILSLSGAFLPAPSPPGATGLTVYLAGGQGQVVGGTVVGQLVASGPVMVIAATFTNATYERLPLEDDGGGVNSGNSPKSGGGAPPTDNIPSSSIPIYNQAPKLLPNGQMHQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G173670`
TK1151 ID	TkA04G173670
OH-1004 ID	LXL04_035659
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.500
Protein coverage (%)	TK1151 96.350 / OH-1004 97.818 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G173670

Location Chr04:44925836-44926840 (+)

Description Similar to AHL20: AT-hook motif nuclear-localized protein 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14465`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs) (By similarity).	Overexpression of AHL20 negatively regulates defenses in Arabidopsis.2010 · DOI: 10.1111/j.1744-7909.2010.00969.x
`At3g55560`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs) (By similarity).	Overexpression of AHL20 negatively regulates defenses in Arabidopsis.2010 · DOI: 10.1111/j.1744-7909.2010.00969.x
`At4g17800`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At2g35270`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At4g12050`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035659 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009908 flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048440 carpel development Biological Process

GO:0048653 anther development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT1G76500

ath:AT2G35270

ath:AT3G04570

ath:AT4G14465

ath:AT4G22810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · TkA04G173670 · TK1151

Cytoplasm0.105

Rank 2 · TkA04G173670 · TK1151

Cell membrane0.034

Rank 3 · TkA04G173670 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA04G173670 · TK1151

Plastid0.014

Rank 5 · TkA04G173670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03479PCC86-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G173670	`PF03479`	PCC	86	203	1.6e-31	109.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWQ2`	Arabidopsis thaliana	sp\|Q8GWQ2\|AHL20_ARATH AT-hook motif nuclear-localized protein 20	53.200%	Swiss-Prot	High
`Q9M2S3`	Arabidopsis thaliana	sp\|Q9M2S3\|AHL15_ARATH AT-hook motif nuclear-localized protein 15	52.100%	Swiss-Prot	High
`O23620`	Arabidopsis thaliana	sp\|O23620\|AHL23_ARATH AT-hook motif nuclear-localized protein 23	71.900%	Swiss-Prot	Medium
`O82166`	Arabidopsis thaliana	sp\|O82166\|AHL21_ARATH AT-hook motif nuclear-localized protein 21	69.100%	Swiss-Prot	Medium
`Q9SZ70`	Arabidopsis thaliana	sp\|Q9SZ70\|AHL26_ARATH AT-hook motif nuclear-localized protein 26	72.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card