TkA04G171900 | RubberDandelionOmics

Gene overview

TkA04G171900

Reference: TK1151 Chr: Chr04 Coordinates: 44475560-44477798 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1582 bp · TkA04G171900|TK1151|cDNA

TTTAAAGCATTTGTTACCCATTTTCTCTATTTATATAAAGCAATCACATCGTGGGCACACTTTTGTGGGCGAGGCCGTCATATTTGAGTCACAGGCTCATAGCATTCCTCTTCTTGTTTGGGAAATGGAGCAATAGTCTTCTTCCTCTCTCCCACAATCATCCACCCATTCCGTCTTTCATTCTTAGATTAAACAAATTCAATTTCTTGTTGACCCATTTCGATTCACGCAGTCTTTCAGCATCTCAAAGAAAAATTCTA...

CDS

Download CDS FASTA

927 bp · TkA04G171900|TK1151|CDS

ATGGACCCCGTAGCCCTCGATAGGATAATCGAACGGTTAATTGAAGTGCGATCGACTAAGCCAGGGAAGTTGGTTCAGCTCTCAGAGGCTGAAATCAAGCAGCTTTGTGTTGCGTCTCGTGAAATCTTTATGAAACAGCCTAATCTTCTTGAACTCGAAGCCCCTATCAAGATTTGCGGCGACATTCATGGACAATACAGCGACCTATTGCGACTCTTCGAATACGGAGGTTTCCCTCCCCAATCCAATTATCTTTTCCT...

Protein

Download Protein FASTA

308 aa · TkA04G171900|TK1151|PROTEIN

MDPVALDRIIERLIEVRSTKPGKLVQLSEAEIKQLCVASREIFMKQPNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPQSNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRFNVKLWKAFTECFNCLPVAALVDDKILCMHGGLSPDLSDLDQIRNLPRPTAIPDTGLLCDLLWSDPSKDVKGWGMNDRGVSYTFGPDKVSEFLTKHDLDLVCRAHQVVEDGYEFFADRQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G171900`
TK1151 ID	TkA04G171900
OH-1004 ID	LXL04_035064
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G171900

Location Chr04:44475560-44477798 (+)

Description Similar to TOPP4: Serine/threonine-protein phosphatase PP1 isozyme 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39840`	Serine/threonine-protein phosphatase that possesses phosphatase activity toward para-nitrophenyl phosphate (pNPP) in vitro.	Arabidopsis DELLA protein degradation is controlled by a type-one protein phosphatase, TOPP4.2014 · DOI: 10.1371/journal.pgen.1004464 TYPE-ONE PROTEIN PHOSPHATASE4 regulates pavement cell interdigitation by modulating PIN-FORMED1 polarity and trafficking in Arabidopsis.2015 · DOI: 10.1104/pp.114.249904 TOPP4 Regulates the Stability of PHYTOCHROME INTERACTING FACTOR5 during Photomorphogenesis in Arabidopsis.2016 · DOI: 10.1104/pp.15.01729
`At5g59160`	Serine/threonine-protein phosphatase that possesses phosphatase activity toward para-nitrophenyl phosphate (pNPP) in vitro.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0268000`	Serine/threonine-protein phosphatase PP1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035064 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0010161 red light signaling pathway Biological Process

GO:0016311 dephosphorylation Biological Process

GO:0000164 protein phosphatase type 1 complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G39840

ath:AT5G59160

dosa:Os03g0268000

nta:107801901

nta:107829724

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.662

Rank 1 · TkA04G171900 · TK1151

Nucleus0.546

Rank 2 · TkA04G171900 · TK1151

Mitochondrion0.058

Rank 3 · TkA04G171900 · TK1151

Cell membrane0.053

Rank 4 · TkA04G171900 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA04G171900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16891STPPase_N6-53 aa

PF00149Metallophos55-248 aa

PF16891STPPase_N233-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G171900	`PF16891`	STPPase_N	6	53	1.2e-21	77.6
TkA04G171900	`PF00149`	Metallophos	55	248	1.8e-50	172.9
TkA04G171900	`PF16891`	STPPase_N	233	243	1.2e-21	77.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P48484`	Arabidopsis thaliana	sp\|P48484\|PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4	88.600%	Swiss-Prot	High
`P48482`	Arabidopsis thaliana	sp\|P48482\|PP12_ARATH Serine/threonine-protein phosphatase PP1 isozyme 2	83.900%	Swiss-Prot	High
`P48489`	Oryza sativa subsp. japonica	sp\|P48489\|PP1_ORYSJ Serine/threonine-protein phosphatase PP1	87.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card