TkA04G166840 | RubberDandelionOmics

Gene overview

TkA04G166840

Reference: TK1151 Chr: Chr04 Coordinates: 43115575-43115886 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · TkA04G166840|TK1151|cDNA

ATGAAATGGCAAACAGTCTATAATGATATAGACTGTGGAATATTTGCTATGAGACACTTGGAGTGTTACACTGGTGGGGTCATTTCCAAATTTGACTGTGGATTGGTAAAAGAATCTGAACAACAATCAGCTCAGTTGATAAAGCTTCGCAAGAAATACGCAACAAAGATTTTGATGAGTGATCTCAACATCAAAATGAAGAGCTTTCTTGAGGATGCAACCAGCTTTCAGAAGATTGAAGAATCAACAAGGAAAAACAT...

CDS

Download CDS FASTA

312 bp · TkA04G166840|TK1151|CDS

ATGAAATGGCAAACAGTCTATAATGATATAGACTGTGGAATATTTGCTATGAGACACTTGGAGTGTTACACTGGTGGGGTCATTTCCAAATTTGACTGTGGATTGGTAAAAGAATCTGAACAACAATCAGCTCAGTTGATAAAGCTTCGCAAGAAATACGCAACAAAGATTTTGATGAGTGATCTCAACATCAAAATGAAGAGCTTTCTTGAGGATGCAACCAGCTTTCAGAAGATTGAAGAATCAACAAGGAAAAACAT...

Protein

Download Protein FASTA

103 aa · TkA04G166840|TK1151|PROTEIN

MKWQTVYNDIDCGIFAMRHLECYTGGVISKFDCGLVKESEQQSAQLIKLRKKYATKILMSDLNIKMKSFLEDATSFQKIEESTRKNILYNAYKDRQKRFNFAF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G166840`
TK1151 ID	TkA04G166840
OH-1004 ID	LXL04_012045
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 8.293 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G166840`
Location	Chr04:43115575-43115886 (-)
Description	Similar to hmu: Halomucin (Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012045` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0007156 homophilic cell-cell adhesion Biological Process GO:0019079 viral genome replication Biological Process GO:0019082 viral protein processing Biological Process GO:0032259 methylation Biological Process GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway Biological Process GO:0039520 symbiont-mediated activation of host autophagy Biological Process GO:0039548 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity Biological Process GO:0039579 symbiont-mediated suppression of host ISG15-protein conjugation Biological Process GO:0039595 symbiont-mediated degradation of host mRNA Biological Process GO:0039648 symbiont-mediated perturbation of host ubiquitin-like protein modification Biological Process GO:0039657 symbiont-mediated suppression of host gene expression Biological Process
KEGG gene cross-reference	hwa:HQ_1081A These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.734

Rank 1 · TkA04G166840 · TK1151

Cytoplasm0.170

Rank 2 · TkA04G166840 · TK1151

Mitochondrion0.052

Rank 3 · TkA04G166840 · TK1151

Extracellular0.026

Rank 4 · TkA04G166840 · TK1151

Cell membrane0.014

Rank 5 · TkA04G166840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02902Peptidase_C486-56 aa

PF02902Peptidase_C4841-98 aa

PF11313DUF311659-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G166840	`PF02902`	Peptidase_C48	6	56	0.0011	19.5
TkA04G166840	`PF02902`	Peptidase_C48	41	98	0.0011	19.5
TkA04G166840	`PF11313`	DUF3116	59	92	0.026	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card