TkA04G165860 | RubberDandelionOmics

Gene overview

TkA04G165860

Reference: TK1151 Chr: Chr04 Coordinates: 42850330-42854376 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1755 bp · TkA04G165860|TK1151|cDNA

TTGGCCTTCCACTTATGCTGTTACGATGTCCATTTTCGTAATTTCATTGCACCTCAATCATTTACCCAACCCCGCTTATAAAATCTACTCCACGAAAGTTTGATATGGAGAGATTTGAGGATGTCGCCGGTCAACTCTGATAATGTAGTTCCACTTCTGCCGGAGCATGATTCACCGTCGACATCCACAGAGGAGAAACAACAGTCGGTTTCAGGAGCTGTGTTCAATGTTTCGACGAGCATAATAGGTGCAGGAATTAT...

CDS

Download CDS FASTA

1323 bp · TkA04G165860|TK1151|CDS

ATGTCGCCGGTCAACTCTGATAATGTAGTTCCACTTCTGCCGGAGCATGATTCACCGTCGACATCCACAGAGGAGAAACAACAGTCGGTTTCAGGAGCTGTGTTCAATGTTTCGACGAGCATAATAGGTGCAGGAATTATGTCGATTCCGGCGACTCTAAAGGTCTTAGGCGTAGTTCCGGCGTTTGTGTTGATCGTACTTATAGCGTGGCTGGTGGATATTTCTGTGGAGTTCATGCTCAGGTTTAGTTACGCTGGAGG...

Protein

Download Protein FASTA

440 aa · TkA04G165860|TK1151|PROTEIN

MSPVNSDNVVPLLPEHDSPSTSTEEKQQSVSGAVFNVSTSIIGAGIMSIPATLKVLGVVPAFVLIVLIAWLVDISVEFMLRFSYAGGSTTYAGLMKESFGRIGSVAVQICVMITNLGCLIIYLIIIGDVLSGAQSGEESVHLGVLQQWFGIHWWNTRNFAILFIVIFVMLPLVLFRRVELLSMSSAVAVLLALVFVGICSAMAISATIKGKTRDIRLLPQLDDGAAFFNLFTAIPVIVTAFTFHFNVHAIGVELGKPAAM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G165860`
TK1151 ID	TkA04G165860
OH-1004 ID	LXL04_035118
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G165860

Location Chr04:42850330-42854376 (-)

Description Similar to AVT6C: Amino acid transporter AVT6C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56200`	Amino acid transporter AVT6C.	No verified direct reference in this release
`At2g40420`	Amino acid transporter AVT6D.	No verified direct reference in this release
`At3g30390`	Amino acid transporter AVT6A.	No verified direct reference in this release
`At5g38820`	Amino acid transporter AVT6B.	No verified direct reference in this release
`At1g80510`	Amino acid transporter AVT6E.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035118 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G80510

ath:AT2G40420

ath:AT3G30390

ath:AT3G56200

ath:AT5G38820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.428

Rank 1 · TkA04G165860 · TK1151

Cell membrane0.199

Rank 2 · TkA04G165860 · TK1151

Endoplasmic reticulum0.183

Rank 3 · TkA04G165860 · TK1151

Golgi apparatus0.151

Rank 4 · TkA04G165860 · TK1151

Cytoplasm0.148

Rank 5 · TkA04G165860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03222Trp_Tyr_perm26-431 aa

PF01490Aa_trans27-415 aa

PF11364DUF316548-72 aa

PF11364DUF3165116-116 aa

PF11364DUF3165156-204 aa

PF11364DUF3165268-276 aa

PF11364DUF3165349-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G165860	`PF03222`	Trp_Tyr_perm	26	431	2.1e-08	34.4
TkA04G165860	`PF01490`	Aa_trans	27	415	3.6e-48	165.0
TkA04G165860	`PF11364`	DUF3165	48	72	0.075	14.3
TkA04G165860	`PF11364`	DUF3165	116	116	0.075	14.3
TkA04G165860	`PF11364`	DUF3165	156	204	0.075	14.3
TkA04G165860	`PF11364`	DUF3165	268	276	0.075	14.3
TkA04G165860	`PF11364`	DUF3165	349	411	0.075	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYM2`	Arabidopsis thaliana	sp\|Q9LYM2\|AVT6C_ARATH Amino acid transporter AVT6C	63.200%	Swiss-Prot	High
`Q0WQJ3`	Arabidopsis thaliana	sp\|Q0WQJ3\|AVT6D_ARATH Amino acid transporter AVT6D	60.000%	Swiss-Prot	High
`Q9LI61`	Arabidopsis thaliana	sp\|Q9LI61\|AVT6A_ARATH Amino acid transporter AVT6A	46.800%	Swiss-Prot	Medium
`F4KBM7`	Arabidopsis thaliana	sp\|F4KBM7\|AVT6B_ARATH Amino acid transporter AVT6B	46.100%	Swiss-Prot	Medium
`Q9M8L9`	Arabidopsis thaliana	sp\|Q9M8L9\|AVT6E_ARATH Amino acid transporter AVT6E	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card