TkA04G165460 | RubberDandelionOmics

Gene overview

TkA04G165460

Reference: TK1151 Chr: Chr04 Coordinates: 42757401-42764375 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1786 bp · TkA04G165460|TK1151|cDNA

TCTTCTTCGCCTTTTCTTCTTATTCGTCTTTTCTTCTTCGTCTTCACGCAGCAGCTTCAATAGCGACCCCAAACTCCCGATCAAATATCACAGTAAGGCCGAGAGAGGGAGAGACGCGTCGGCATGGCGGGATATCGTCGGACGGAATCAGCGAGAGAGGGAGCAGGGAGACCGACGGACGATCGTTGCGACCACCGAAGCAGCAGGGGCAGCCGCGACAGGCGCTGCAACTCGCCGGCGACGAACCTTCGGTCTTTTGA...

CDS

Download CDS FASTA

1479 bp · TkA04G165460|TK1151|CDS

ATGGACCGAACCCTACAATCACCGAATGTTGCAGACAATTGTGTGCCGATTTCAGAGATCAACCCTAGGGTTGAGATTGATACATCGCCGCCGTTTGGGTCGGTGAAGGAGGCGGTGACTCGATTTGGAGGAAGTGGTTCGTGGGTTCCACTTAATGTCCTTCGACTCGCCGGTCAAGATCCAGAAGAAATGGATATGGATACCGTCGAGAAACAAGCTGCCGAACTCGAAAAAGAACTAATTACTAAGGAACAAGAAAC...

Protein

Download Protein FASTA

492 aa · TkA04G165460|TK1151|PROTEIN

MDRTLQSPNVADNCVPISEINPRVEIDTSPPFGSVKEAVTRFGGSGSWVPLNVLRLAGQDPEEMDMDTVEKQAAELEKELITKEQETLEVLRELEFAKGVMEGLKLNLNKETSSIITTLNLNPDSRPTTPVDQSTPTLTLCPVPLPPGIILTELKEAKSNLNKTTKDLTMIRASVESLNKKLRTHKSNLAEKDGETKRVIEESVDTTNGFCKLTFEGQQFRRMEEAAQYEVIKATSEIENTKLSIKMVEMRLIAAKKMEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G165460`
TK1151 ID	TkA04G165460
OH-1004 ID	LXL04_035119
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G165460

Location Chr04:42757401-42764375 (-)

Description Similar to At2g40480: WEB family protein At2g40480

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40480`	WEB family protein At2g40480.	No verified direct reference in this release
`At3g51720`	WEB family protein At3g51720.	No verified direct reference in this release
`At2g38370`	WEB family protein At2g38370.	No verified direct reference in this release
`At3g56270`	WEB family protein At3g56270.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035119 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009903 chloroplast avoidance movement Biological Process

GO:0009904 chloroplast accumulation movement Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G38370

ath:AT2G40480

ath:AT3G51720

ath:AT3G56270

ath:AT4G33390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.395

Rank 1 · TkA04G165460 · TK1151

Cell membrane0.369

Rank 2 · TkA04G165460 · TK1151

Nucleus0.337

Rank 3 · TkA04G165460 · TK1151

Plastid0.065

Rank 4 · TkA04G165460 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA04G165460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05701WEMBL24-110 aa

PF24918NET2A_C59-121 aa

PF30081MAL13P1_147_C62-110 aa

PF12761End364-86 aa

PF21664TBPIP_C64-99 aa

PF00875DNA_photolyase69-94 aa

PF05701WEMBL152-305 aa

PF24918NET2A_C153-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G165460	`PF05701`	WEMBL	24	110	2e-25	90.3
TkA04G165460	`PF24918`	NET2A_C	59	121	3.2	8.3
TkA04G165460	`PF30081`	MAL13P1_147_C	62	110	6.2	7.8
TkA04G165460	`PF12761`	End3	64	86	0.012	16.5
TkA04G165460	`PF21664`	TBPIP_C	64	99	0.1	13.3
TkA04G165460	`PF00875`	DNA_photolyase	69	94	1.1	10.0
TkA04G165460	`PF05701`	WEMBL	152	305	2e-25	90.3
TkA04G165460	`PF24918`	NET2A_C	153	206	3.2	8.3
TkA04G165460	`PF12761`	End3	156	191	0.012	16.5
TkA04G165460	`PF00875`	DNA_photolyase	168	236	1.1	10.0
TkA04G165460	`PF21664`	TBPIP_C	174	227	0.1	13.3
TkA04G165460	`PF30081`	MAL13P1_147_C	188	250	6.2	7.8
TkA04G165460	`PF00875`	DNA_photolyase	410	440	1.1	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XVC7`	Arabidopsis thaliana	sp\|Q5XVC7\|Y2048_ARATH WEB family protein At2g40480	32.800%	Swiss-Prot	Medium
`Q9SCT6`	Arabidopsis thaliana	sp\|Q9SCT6\|Y3172_ARATH WEB family protein At3g51720	34.300%	Swiss-Prot	Medium
`F4ISY0`	Arabidopsis thaliana	sp\|F4ISY0\|Y2837_ARATH WEB family protein At2g38370	31.300%	Swiss-Prot	Medium
`Q9LYL6`	Arabidopsis thaliana	sp\|Q9LYL6\|Y3270_ARATH WEB family protein At3g56270	28.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card