TkA04G164080 | RubberDandelionOmics

Gene overview

TkA04G164080

Reference: TK1151 Chr: Chr04 Coordinates: 42371218-42373945 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1612 bp · TkA04G164080|TK1151|cDNA

TAAACACACGTGTTGAGAGTTCCTTTCACGTCTCCTTATTTGAACGAATATTCTCTCGAGTTCATCTGGAAACGACTAAACAGCTCAACTAGGAAGTCCACTCTCCATAATCCGTAGTCTCAGATTATGGAACTCAAATACAGTAAGATTACCGTTTGCAAGTCATCTCAACTGGCTATGGATTACAAGACAGTTGTTGCCTTAGCAATTTTGTTTCTATCGACGGTATCATCAGCTCGAGTGTTGCCATTGCCGATCAT...

CDS

Download CDS FASTA

948 bp · TkA04G164080|TK1151|CDS

ATGGAACTCAAATACAGTAAGATTACCGTTTGCAAGTCATCTCAACTGGCTATGGATTACAAGACAGTTGTTGCCTTAGCAATTTTGTTTCTATCGACGGTATCATCAGCTCGAGTGTTGCCATTGCCGATCATTGCGAAGCCAGATGGTGTTGTCAATGTTTTTGATAATTCCAAGTATGGATTGCTCCAGCTCAGTAATGGATTGGCTCAGACTCCTCAGATGGGATGGAACAGTTGGAATTTCTTCGCTTGCAACAT...

Protein

Download Protein FASTA

315 aa · TkA04G164080|TK1151|PROTEIN

MELKYSKITVCKSSQLAMDYKTVVALAILFLSTVSSARVLPLPIIAKPDGVVNVFDNSKYGLLQLSNGLAQTPQMGWNSWNFFACNINESLIKETADALVSSGLADLGYNYVNIDDCWEAPTRDIKGQLVPDPKTFPSGIKALADYVHGKGLKLGIYSSAGVFTCQVRPASLFHENDDAATWASWGVDYLKYDNCFNLGIKPIDRYPPMRDALNATGRTIFYSLCEWGEDDPALWAGNVGNSWRTTDDINDTWASMTTIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G164080`
TK1151 ID	TkA04G164080
OH-1004 ID	LXL04_035135
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	95.500
Protein coverage (%)	TK1151 99.683 / OH-1004 72.018 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G164080

Location Chr04:42371218-42373945 (-)

Description Similar to AGAL3: Alpha-galactosidase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56310`	May regulate leaf (and possibly other organ) development by functioning in cell wall loosening and cell wall expansion.	No verified direct reference in this release
`At5g08370`	May regulate leaf (and possibly other organ) development by functioning in cell wall loosening and cell wall expansion.	An alpha-galactosidase with an essential function during leaf development.2007 · DOI: 10.1007/s00425-006-0350-9
`At5g08380`	May regulate leaf (and possibly other organ) development by functioning in cell wall loosening and cell wall expansion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035135 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009620 response to fungus Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0051682 galactomannan catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT3G56310

ath:AT5G08370

dosa:Os10g0493600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.502

Rank 1 · TkA04G164080 · TK1151

Lysosome / Vacuole0.246

Rank 2 · TkA04G164080 · TK1151

Cytoplasm0.094

Rank 3 · TkA04G164080 · TK1151

Endoplasmic reticulum0.076

Rank 4 · TkA04G164080 · TK1151

Plastid0.050

Rank 5 · TkA04G164080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16499Melibiase_272-314 aa

PF02065Melibiase78-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G164080	`PF16499`	Melibiase_2	72	314	2.1e-71	241.3
TkA04G164080	`PF02065`	Melibiase	78	157	0.0059	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VXZ7`	Arabidopsis thaliana	sp\|Q8VXZ7\|AGAL3_ARATH Alpha-galactosidase 3	79.000%	Swiss-Prot	High
`Q8RX86`	Arabidopsis thaliana	sp\|Q8RX86\|AGAL2_ARATH Alpha-galactosidase 2	63.900%	Swiss-Prot	High
`Q9FT97`	Arabidopsis thaliana	sp\|Q9FT97\|AGAL1_ARATH Alpha-galactosidase 1	64.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card