TkA04G163680 | RubberDandelionOmics

Gene overview

TkA04G163680

Reference: TK1151 Chr: Chr04 Coordinates: 42259764-42262717 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1820 bp · TkA04G163680|TK1151|cDNA

TGGGAATCCCCGGAAATGTGGGGTTTAAAAGGTTCTGAAAACAACCAAATAAGTGAGTGTGGAATGCGTGGAGGGGATAAAGTGCAGTCACTGGGTAACAATGGCGTTTCTCTGTGAACCGTCATCGTCGGCCTCTTTCCTCTCCAGTAATTCATCATCATATTCACAGTCTCCGTTTCAAGTCAAGCTGCTTCATCATAATTTCTCTCCTGCACCAAATTTGGGCAAACAATTCTTCTTATACACCACTGTACATCAAA...

CDS

Download CDS FASTA

960 bp · TkA04G163680|TK1151|CDS

ATGGCTTCCCATGTTGCAGGTAGAAAGACGCAAATGGAAGTAAATATGCTTGTACGTGACCCTCAAATCTGTCAATCTATAAACCAGAACCATTGTAATGGTAAGTATTTTCCAGACCACAAGCTACCAGAAAACGTGACAGCAACAACAGATGCAAAGGCGGCTTTCAGTAATGCAGACTTTTGCCTCCATGCTGTACCAGTACAGTTCAGTGCTTCCTTCCTGGAGGATGTTGCTGAGTATGTGGAGCCAGGCCTTCC...

Protein

Download Protein FASTA

319 aa · TkA04G163680|TK1151|PROTEIN

MASHVAGRKTQMEVNMLVRDPQICQSINQNHCNGKYFPDHKLPENVTATTDAKAAFSNADFCLHAVPVQFSASFLEDVAEYVEPGLPFISLSKGLELNTLRMMSQIIPQTLRNSRQPFVALSGPSFALELMNNLPTAMVVASKDKKLANAVQQLLASRNLRISTTSDVTGVEIAGALKNVLAIAAGIVEGLNLGNNSMAALVAQGCSEIRWLSTKMGAKSTTISGLSGTGDIMLTCFVSLSRNRTVGVRLGSGETLDDIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G163680`
TK1151 ID	TkA04G163680
OH-1004 ID	LXL04_035140
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 69.956 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G163680

Location Chr04:42259764-42262717 (-)

Description Similar to GLY1: Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40690`	Required to supply glycerol-3-phosphate in the chloroplast for the synthesis of glycerolipids.	The Arabidopsis thaliana dihydroxyacetone phosphate reductase gene SUPPRESSSOR OF FATTY ACID DESATURASE DEFICIENCY1 is required for glycerolipid metabolism and for the activation of systemic acquired resistance.2004 · DOI: 10.1105/tpc.016907 Plastid omega3-fatty acid desaturase-dependent accumulation of a systemic acquired resistance inducing activity in petiole exudates of Arabidopsis thaliana is independent of jasmonic acid.2008 · DOI: 10.1111/j.1365-313x.2007.03400.x Biochemical and Molecular-Genetic Characterization of SFD1's Involvement in Lipid Metabolism and Defense Signaling.2012 · DOI: 10.3389/fpls.2012.00026

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0229800`	Required to supply glycerol-3-phosphate in the chloroplast for the synthesis of glycerolipids.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035140 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006072 glycerol-3-phosphate metabolic process Biological Process

GO:0006650 glycerophospholipid metabolic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0045017 glycerolipid biosynthetic process Biological Process

GO:0046167 glycerol-3-phosphate biosynthetic process Biological Process

GO:0046168 glycerol-3-phosphate catabolic process Biological Process

GO:0046486 glycerolipid metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G40690

dma:DMR_11830

dosa:Os07g0229800

lbj:LBJ_0395

lic:LIC_13145

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.419

Rank 1 · TkA04G163680 · TK1151

Cytoplasm0.386

Rank 2 · TkA04G163680 · TK1151

Nucleus0.165

Rank 3 · TkA04G163680 · TK1151

Plastid0.068

Rank 4 · TkA04G163680 · TK1151

Peroxisome0.058

Rank 5 · TkA04G163680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01210NAD_Gly3P_dh_N10-147 aa

PF01118Semialdhyde_dh33-98 aa

PF01118Semialdhyde_dh141-168 aa

PF07479NAD_Gly3P_dh_C167-307 aa

PF20618GPD_NAD_C_bact187-192 aa

PF20618GPD_NAD_C_bact227-293 aa

PF08546ApbA_C267-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G163680	`PF01210`	NAD_Gly3P_dh_N	10	147	6.8e-36	124.4
TkA04G163680	`PF01118`	Semialdhyde_dh	33	98	0.14	13.3
TkA04G163680	`PF01118`	Semialdhyde_dh	141	168	0.14	13.3
TkA04G163680	`PF07479`	NAD_Gly3P_dh_C	167	307	1.7e-49	168.4
TkA04G163680	`PF20618`	GPD_NAD_C_bact	187	192	1.5e-21	77.4
TkA04G163680	`PF20618`	GPD_NAD_C_bact	227	293	1.5e-21	77.4
TkA04G163680	`PF08546`	ApbA_C	267	297	0.014	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949Q0`	Arabidopsis thaliana	sp\|Q949Q0\|GPDA2_ARATH Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, chloroplastic	86.500%	Swiss-Prot	High
`Q8H2J9`	Oryza sativa subsp. japonica	sp\|Q8H2J9\|GPDA_ORYSJ Glycerol-3-phosphate dehydrogenase [NAD(+)], chloroplastic	79.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card