TkA04G163160 | RubberDandelionOmics

Gene overview

TkA04G163160

Reference: TK1151 Chr: Chr04 Coordinates: 42139709-42151987 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1983 bp · TkA04G163160|TK1151|cDNA

TTTTGCTGTTTGGGTCAAAATCTCATCTTCAATCCGTTTATGAACGTACTCAATAGTGGCAGGTTTAAGTTCAAGTATGAAACCACGTCATTTAGGCGAAGAATCCCGTGGAGTATTAACGGCCTTATAAACCAAAACTCGGAACATAGAGTCAGTACGAAACAGCAACGGTGGTTGGTTCCCGCCGAATTGTACTCCCACTCTTGATTTTGGTTGCCGATGCAAAATTGGAACTAAAGATCCAGTTCCCAATGATTTCG...

CDS

Download CDS FASTA

1398 bp · TkA04G163160|TK1151|CDS

ATGATTTCGAGCATGTGTGTAGTACATAACCAGTTCGTGTTCCCTGGCCAACCGGCGCATCTAAAGGTCCCTTTGCTTGAACTGAAACCATCGGCGTTGCAGTCCGAACTTGACAGAAAACGTCATTCCGCAATCGTCACTGCAGCATCCTCTTCATTCGCTGGCTCCGGCGCTGAATATTCTGAACCATTGCCCACAGTCCGGAAGAAGAAAGCAAGGAGAATAGTTGGCATAGACCAGGATGAACTAGTCGACCCCAA...

Protein

Download Protein FASTA

465 aa · TkA04G163160|TK1151|PROTEIN

MISSMCVVHNQFVFPGQPAHLKVPLLELKPSALQSELDRKRHSAIVTAASSSFAGSGAEYSEPLPTVRKKKARRIVGIDQDELVDPKLLADDDSCFCEFQGLQLHHKICEPESESQDSIQYDATSDSSYHNEKVSFPLILLHGFGASLFSWNTVMKRLAKISGSKVLSFDRPAFGLTSRVENPSKHAPSSDGQDTKPLNPYSMAFSVLATLYFIDFLTAEKAILVGHSAGCLVAAQTYFKAPERVAAMILVAPAIIAPLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G163160`
TK1151 ID	TkA04G163160
OH-1004 ID	LXL04_035147
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 87.527 / OH-1004 89.648 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G163160`
Location	Chr04:42139709-42151987 (-)
Description	Similar to abhd-5.2: Abhydrolase domain-containing protein abhd-5.2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035147` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006654 phosphatidic acid biosynthetic process Biological Process GO:0016042 lipid catabolic process Biological Process GO:0055088 lipid homeostasis Biological Process GO:0005811 lipid droplet Cellular Component GO:0004620 glycerophospholipase activity Molecular Function GO:0042171 lysophosphatidic acid acyltransferase activity Molecular Function GO:0052689 carboxylic ester hydrolase activity Molecular Function
KEGG gene cross-reference	cel:CELE_C37H5.2 cel:CELE_C37H5.3 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · TkA04G163160 · TK1151

Mitochondrion0.030

Rank 2 · TkA04G163160 · TK1151

Cytoplasm0.026

Rank 3 · TkA04G163160 · TK1151

Peroxisome0.023

Rank 4 · TkA04G163160 · TK1151

Nucleus0.021

Rank 5 · TkA04G163160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00326Peptidase_S9114-143 aa

PF02230Abhydrolase_2136-157 aa

PF00561Abhydrolase_1137-449 aa

PF12697Abhydrolase_6138-453 aa

PF12146Hydrolase_4138-259 aa

PF20408Abhydrolase_11138-252 aa

PF03959FSH1139-160 aa

PF07859Abhydrolase_3147-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G163160	`PF00326`	Peptidase_S9	114	143	0.00027	21.2
TkA04G163160	`PF02230`	Abhydrolase_2	136	157	0.0013	19.3
TkA04G163160	`PF00561`	Abhydrolase_1	137	449	2.2e-23	83.9
TkA04G163160	`PF12697`	Abhydrolase_6	138	453	3e-22	81.1
TkA04G163160	`PF12146`	Hydrolase_4	138	259	1e-12	48.6
TkA04G163160	`PF20408`	Abhydrolase_11	138	252	0.017	15.6
TkA04G163160	`PF03959`	FSH1	139	160	0.051	14.0
TkA04G163160	`PF07859`	Abhydrolase_3	147	170	0.068	13.6
TkA04G163160	`PF03096`	Ndr	214	254	0.00011	21.7
TkA04G163160	`PF00326`	Peptidase_S9	216	253	0.00027	21.2
TkA04G163160	`PF02230`	Abhydrolase_2	217	262	0.0013	19.3
TkA04G163160	`PF10230`	LIDHydrolase	219	320	0.001	19.6
TkA04G163160	`PF20434`	BD-FAE	219	235	0.046	13.9
TkA04G163160	`PF07859`	Abhydrolase_3	219	261	0.068	13.6
TkA04G163160	`PF06821`	Ser_hydrolase	220	272	1.7e-08	35.3
TkA04G163160	`PF03959`	FSH1	224	235	0.051	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card