TkA04G157940 | RubberDandelionOmics

Gene overview

TkA04G157940

Reference: TK1151 Chr: Chr04 Coordinates: 40862975-40863847 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

780 bp · TkA04G157940|TK1151|cDNA

ATGGAAGATGCTCTTTGTATAGAAAAACAGTTCGTAGGTGACGAAAACTCAATAAAGTTTGATTTTTATGGTGTTTACGATGGCCATGGTGGCTCCCGTGTTGCGTACGCATGTCGTGAGCGGTTACATAAGTTACTGGCGGCGGAAATGAACATTCAAAATAGAAGCACGACGGCGGAGATGAACTGGGAAAATTTGATGGTGGAGAGCTTCACGAAAATGGATGAGGAAGTGAATGAAACTGATGTCGTGGATTCCAT...

CDS

Download CDS FASTA

780 bp · TkA04G157940|TK1151|CDS

ATGGAAGATGCTCTTTGTATAGAAAAACAGTTCGTAGGTGACGAAAACTCAATAAAGTTTGATTTTTATGGTGTTTACGATGGCCATGGTGGCTCCCGTGTTGCGTACGCATGTCGTGAGCGGTTACATAAGTTACTGGCGGCGGAAATGAACATTCAAAATAGAAGCACGACGGCGGAGATGAACTGGGAAAATTTGATGGTGGAGAGCTTCACGAAAATGGATGAGGAAGTGAATGAAACTGATGTCGTGGATTCCAT...

Protein

Download Protein FASTA

259 aa · TkA04G157940|TK1151|PROTEIN

MEDALCIEKQFVGDENSIKFDFYGVYDGHGGSRVAYACRERLHKLLAAEMNIQNRSTTAEMNWENLMVESFTKMDEEVNETDVVDSMGSTAVVAVVGDKEIVVANCGDSRAVLSRGGFSVPLSVDHKPDRPDELERIECSGGRVIDWNGLRVLGVLATSRAIGDRQLKPYVIPKPEVTVNKREDADEFMILASDGLWDVISNDLACQVVRKCLDGWTCRRRSLKENHVRTNNAAVFLTELAMARGSKDNISVIVVNLKH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G157940`
TK1151 ID	TkA04G157940
OH-1004 ID	LXL04_035180
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 77.313 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G157940

Location Chr04:40862975-40863847 (-)

Description Similar to Os01g0656200: Probable protein phosphatase 2C 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11410`	Major negative regulator of abscisic acid (ABA) responses during seed germination and cold acclimation.	Antisense inhibition of protein phosphatase 2C accelerates cold acclimation in Arabidopsis thaliana.2001 · DOI: 10.1046/j.1365-313x.2001.01048.x Physical and functional interaction of the Arabidopsis K(+) channel AKT2 and phosphatase AtPP2CA.2002 · DOI: 10.1105/tpc.000943 ABA-hypersensitive germination3 encodes a protein phosphatase 2C (AtPP2CA) that strongly regulates abscisic acid signaling during germination among Arabidopsis protein phosphatase 2Cs.2006 · DOI: 10.1104/pp.105.070128 The protein phosphatase AtPP2CA negatively regulates abscisic acid signal transduction in Arabidopsis, and effects of abh1 on AtPP2CA mRNA.2006 · DOI: 10.1104/pp.105.070318 ABA-Hypersensitive Germination1 encodes a protein phosphatase 2C, an essential component of abscisic acid signaling in Arabidopsis seed.2007 · DOI: 10.1111/j.1365-313x.2007.03107.x ABI1 and PP2CA phosphatases are negative regulators of Snf1-related protein kinase1 signaling in Arabidopsis.2013 · DOI: 10.1105/tpc.113.114066
`At2g29380`	Probable protein phosphatase 2C 24.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0656200`	Probable protein phosphatase 2C 8.	No verified direct reference in this release
`Os05g0572700`	Protein phosphatase that acts as a positive regulator of seed germination.	The protein phosphatase 2C clade A protein OsPP2C51 positively regulates seed germination by directly inactivating OsbZIP10.2017 · DOI: 10.1007/s11103-016-0568-2
`Os09g0325700`	Involved in the regulation of abiotic stress responses.	A novel nuclear protein phosphatase 2C negatively regulated by ABL1 is involved in abiotic stress and panicle development in rice.2013 · DOI: 10.1007/s12033-012-9614-8 ABA inducible rice protein phosphatase 2C confers ABA insensitivity and abiotic stress tolerance in Arabidopsis.2015 · DOI: 10.1371/journal.pone.0125168

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035180 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G29380

dosa:Os01g0656200

dosa:Os01g0846300

dosa:Os05g0572700

dosa:Os09g0325700

osa:4346736

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529

Rank 1 · TkA04G157940 · TK1151

Nucleus0.510

Rank 2 · TkA04G157940 · TK1151

Cell membrane0.097

Rank 3 · TkA04G157940 · TK1151

Lysosome / Vacuole0.052

Rank 4 · TkA04G157940 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA04G157940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C1-250 aa

PF13672PP2C_229-124 aa

PF13672PP2C_2184-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G157940	`PF00481`	PP2C	1	250	2.4e-66	224.7
TkA04G157940	`PF13672`	PP2C_2	29	124	0.00025	21.4
TkA04G157940	`PF13672`	PP2C_2	184	200	0.00025	21.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49598`	Arabidopsis thaliana	sp\|P49598\|P2C37_ARATH Protein phosphatase 2C 37	52.300%	Swiss-Prot	High
`Q9ZW21`	Arabidopsis thaliana	sp\|Q9ZW21\|P2C24_ARATH Probable protein phosphatase 2C 24	52.700%	Swiss-Prot	High
`Q5SN75`	Oryza sativa subsp. japonica	sp\|Q5SN75\|P2C08_ORYSJ Probable protein phosphatase 2C 8	56.100%	Swiss-Prot	High
`Q65XK7`	Oryza sativa subsp. japonica	sp\|Q65XK7\|P2C51_ORYSJ Protein phosphatase 2C 51	53.000%	Swiss-Prot	High
`Q0J2L7`	Oryza sativa subsp. japonica	sp\|Q0J2L7\|P2C68_ORYSJ Probable protein phosphatase 2C 68	54.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card